KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0531Help
Entry
Cpha266_0531      CDS       T00439                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
cph01130  Biosynthesis of antibiotics
cph01230  Biosynthesis of amino acids
Module
cph_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpha266_0531
Enzymes [BR:cph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cpha266_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABL64588
JGI: Cpha2660531
UniProt: A1BDW1
Position
584409..585185
Genome map
AA seq 258 aa AA seqDB search
MTYLSRILEEKRQAVLALKQQRPLQHYLEQETELSPCRDFQGCLKRSVDRIKLIAEIKKA
SPSRGLIVSDFKPLEMARRYMDLGASAFSVLTEEVFFQGSPDYLKEVRRAFSLPVLRKDF
ILDECQIFESRLMGADAILLIVAALDPHQLQDYLDLARQTGLHVLVEVHDHRELDIALNA
GSMIIGINNRDLRDFSVNLHTSIKLRPYIPEGIVSVSESGVKTAADAALLDNASFDAVLI
GEGLHVSEDLKRVIWTET
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacctatctgtcaaggattctcgaagagaagcgccaggctgtgcttgcgttgaagcaa
cagcggccgcttcagcactatcttgaacaggaaacagagctttcgccgtgcagggatttt
cagggctgcctgaaacgttctgttgacaggataaagctgatagccgaaataaaaaaagcc
tcaccatcacgcggtcttattgtaagcgattttaagccgctggaaatggcccggcgttat
atggatcttggcgcatcagctttttccgtactgaccgaagaggtgttttttcagggctct
ccggattatcttaaagaggtacgtcgagctttttccctgcctgtattgcgcaaggatttt
atcctggatgaatgtcagatattcgaatcgcgcctgatgggtgccgatgccatattgctt
atcgttgcagcgcttgatccacaccagttacaggattatctcgatcttgctcgtcaaaca
gggctgcacgtgcttgttgaagttcatgatcacagggagctcgatatcgcacttaatgca
ggatccatgatcatcggcatcaacaacagggatcttagggacttcagcgttaatctccac
acctcgatcaagctgcggccgtacatcccggaggggattgtttctgtttcggaaagcggc
gtcaaaactgccgccgacgcagctcttctcgacaatgcatcgtttgatgctgtacttatc
ggtgaagggctgcatgtgagcgaagaccttaagcgggttatctggactgagacttga

DBGET integrated database retrieval system