KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0550Help
Entry
Cpha266_0550      CDS       T00439                                 

Definition
(RefSeq) acetyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpha266_0550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpha266_0550
   00620 Pyruvate metabolism
    Cpha266_0550
   00640 Propanoate metabolism
    Cpha266_0550
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpha266_0550
   00680 Methane metabolism
    Cpha266_0550
Enzymes [BR:cph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cpha266_0550
Lipid biosynthesis proteins [BR:cph01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cpha266_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(610511..612514)
Genome map
AA seq 667 aa AA seqDB search
MATDEKTSSNQPTASPALIEESISSVMTEKRKFPPPVEFSNSAHVSSMEEYEKLYAAAAE
DPETYWAGLAEQFHWFKKWDSVLEWKTPYAKWFNGGKTNICYNAVDVHMNSWRKNKAAIL
WEGEEGDQRVLTYGELHRQVSKFANVLKIAGIKPGDRVAIYMGMVPELVIAVLACARVGA
VHNVIFAGFSAHAITERVNDSRAKMVICCDGTRRRGSTINLKKIVDEAIVNTPSVRNVIV
LKVTSETVSMHDGMDHWWHDLMGLAMDVSEPVEVDSEHPLFVLYTSGSTGKPKGILHTTA
GYMVHAASSFKYVFDIKDEDIYWCTADVGWITGHSYMVYGPLLNGATLLMYEGAPNYPQW
DRFWDIINRYKVTILYTAPTAIRAFIRAGNEWVTKHDLSSLRLLGTVGEPINPEAWMWYH
RVVGQEKCPIVDTWWQTETGGIMVSPFPGATPTKPGTATRPLPGIMVDVVRKDGVSCNAN
EGGYLVIKKPWPSMLRTIYGDNERYEKTYWSEFNDMYFTGDGARKDEDGYIWIMGRVDDV
VNVSGHRLGTSEVESALVSHEAVAEAAVVSRPDDIKGNSLVAFVTLKDEYEGDMKLRESL
RNHVAKEIGPIAKPDEIRWAKGLPKTRSGKIMRRLLRELATSNEVKGDVTTLEDFGVLEN
LRDQEDE
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgacgaaaaaacatccagcaaccaaccaacagcctcacccgctttaatcgag
gaatccatcagttcagttatgactgaaaagcgcaagtttcctcctccggtggagttctcc
aacagtgctcatgtatcctcaatggaagaatatgagaagctgtatgctgcagcagccgaa
gatccggaaacctactgggctgggttggctgaacagttccactggtttaaaaaatgggac
agtgtgctggaatggaaaacgccttatgcaaaatggtttaacggcggaaaaaccaatatc
tgctacaatgctgttgatgtccacatgaacagttggagaaaaaacaaggcggcaattctc
tgggagggcgaagagggcgatcagcgggtactcacctatggcgaactgcacaggcaggta
agcaaatttgccaatgtccttaaaattgcaggcatcaagcctggtgacagggttgccatt
tatatgggaatggtccctgagcttgttattgcggttcttgcatgcgcaagagtcggcgcg
gttcataacgtgatttttgcaggattttcagcacatgccatcaccgaacgcgtcaacgat
tcaagggcaaagatggttatctgctgcgacggaaccagacgccggggaagtacgatcaat
ctgaaaaaaattgttgacgaagcaatcgtcaacaccccatctgtccgaaacgttatcgtc
ctgaaagtcaccagtgaaacggtcagcatgcatgacggcatggaccattggtggcatgat
ctcatgggattggctatggacgtttctgaaccggtcgaggtggattccgaacatccgctc
tttgtcctctataccagcggttcaacaggcaagcccaaaggcattctgcatacaacagca
ggctatatggttcacgccgcaagctccttcaaatacgtttttgatataaaggatgaggac
atttactggtgtacggccgatgtaggctggattaccggacacagttacatggtttatgga
ccattgctcaacggggcaacgcttctcatgtatgaaggcgcgccgaactaccctcagtgg
gatcgattctgggacatcatcaaccgttataaagtcaccattctctacaccgcacctacc
gctatccgcgcctttatccgtgcaggtaacgaatgggtaacgaaacatgatctcagctcg
ctcagactgcttggaaccgtcggagagcctatcaatcctgaagcctggatgtggtaccat
cgggttgtaggacaggaaaaatgtccgatcgtcgacacctggtggcagaccgagaccgga
ggcatcatggtatctccgtttccgggcgcaacacccacaaaaccgggaacggcaacccga
ccgctgcccggcatcatggttgacgttgtccgcaaggatggcgtttcctgcaatgccaat
gaaggaggatatctcgttatcaaaaagccatggccctccatgctcaggaccatttacggc
gacaacgagcgatacgaaaaaacctactggtcagagttcaacgacatgtactttaccggc
gacggtgcaagaaaagacgaggacggttacatctggattatgggtcgtgtggatgatgtg
gtcaacgtttcaggacaccgtcttggcaccagcgaagtcgaaagcgcgcttgtttcccat
gaagccgttgcggaagctgccgttgtcagccgcccggacgacatcaaaggcaactcactc
gtcgcgtttgtcacgctcaaggatgagtatgaaggcgatatgaaactcagagaatcgttg
cgcaaccatgttgccaaggagatcggaccgattgcaaaacccgatgaaatcagatgggca
aaaggcctcccgaagactcgcagcggaaaaatcatgcgacgccttctgcgcgaacttgct
acgagcaatgaagttaaaggcgacgttacgacgcttgaagatttcggtgtgcttgaaaac
ctgcgtgaccaggaagacgaataa

DBGET integrated database retrieval system