KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0589Help
Entry
Cpha266_0589      CDS       T00439                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpha266_0589
   01230 Biosynthesis of amino acids
    Cpha266_0589
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpha266_0589
   00030 Pentose phosphate pathway
    Cpha266_0589
   00051 Fructose and mannose metabolism
    Cpha266_0589
   00052 Galactose metabolism
    Cpha266_0589
  Energy metabolism
   00680 Methane metabolism
    Cpha266_0589
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Cpha266_0589
Enzymes [BR:cph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cpha266_0589
Protein phosphatases and associated proteins [BR:cph01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cpha266_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(659232..660437)
Genome map
AA seq 401 aa AA seqDB search
MKKIGILTSGGDCGGLNAVLKGAALMAQSKNLEMYIIPNGYAGLYNLIDQNRLVRLDSER
LDRFDASFAGSEAGHSRVKIKAISNPEKYARIKAGMKKFELDALIISGGDDSGSVMIDLN
HNGIQCIHAPKTMDLDLQTYSVGGDSTINRIAQFVHDLKTTGKTHNRVLVTEVFGRYAGH
TAFRSGIAAEADCILIPEIPVDWNAVYEHLAERFTRRIRESDVHSGTYTIVVAEGMKNAD
GTDIVDESAGLDAFGHKKLAGAGKYTCQQIQKNMKADPAMPIFMKETGMFVEGIYEIPEV
REIHPGHLVRSGNSSAYDINFGFEAGAAAVLLLLDGKTGVTISKVKGRKVEYIESSKAIM
QRYVDLEHVAMYEALGICFGRKPVAYDPILREVDGVYERIY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatcggaatcctgaccagcggcggggattgcggaggactcaatgccgtgctg
aaaggcgcagcactgatggcgcagtcaaaaaatctcgaaatgtacattattccaaacggg
tatgcgggattgtacaaccttatcgatcagaacagacttgtcagacttgacagtgaacgt
cttgacagatttgacgcaagttttgccggttccgaagctggccattcaagagttaaaatc
aaggctatcagcaatccggaaaaatatgcccgcatcaaggccggtatgaaaaaattcgag
cttgacgccctcatcatcagcggcggagatgattccggaagcgttatgattgatctcaac
cataacggtattcagtgtattcatgcaccaaaaacgatggaccttgacctgcagacctat
tcggttggcggtgattcaaccatcaatcgtatagcccagtttgttcacgatctcaaaacc
acgggaaaaacccataacagggtgctggtaaccgaagtattcggacgatatgccggtcac
acggcattccgcagtggtattgccgcagaagccgactgtattcttatacccgagattcct
gttgactggaatgctgtctatgagcatcttgcagaacgctttacccgccgcatcagagaa
agcgacgtccatagcggcacctacacgatcgttgtagcagaaggaatgaaaaacgcagat
ggcaccgatattgttgatgaatccgcaggtctcgatgcatttggacacaaaaaacttgcc
ggagccggaaaatatacctgccagcaaattcagaaaaacatgaaggccgaccctgccatg
ccgatcttcatgaaagagaccggcatgtttgtggaaggcatttatgaaataccggaagtc
cgtgaaatccatcccggtcaccttgtccgttccggaaactcgtcagcctacgatatcaac
ttcggctttgaagcaggggctgcggcagtgcttctccttcttgacggcaaaacaggcgtg
acgatatcaaaagtcaagggtcgcaaagtagaatatatcgaatcaagcaaagctatcatg
cagcgctatgtcgaccttgagcatgtcgccatgtacgaagctctcggaatatgtttcgga
cgcaaacccgttgcctacgatccaatcctccgcgaagttgacggcgtttacgaacgcatc
tactga

DBGET integrated database retrieval system