KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0623Help
Entry
Cpha266_0623      CDS       T00439                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpha266_0623
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpha266_0623
   00640 Propanoate metabolism
    Cpha266_0623
   00660 C5-Branched dibasic acid metabolism
    Cpha266_0623
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpha266_0623
Enzymes [BR:cph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cpha266_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(700083..701261)
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQGKDILRKFGVAVPKGIVAFSPEEAKQAAIQLFEEQNSPVVVIKAQIHAGGRGK
AGGVKLAKSPEEVFDIAQQMLGITLVTHQTGPEGKEVRRLLVEEGMNIDKEFYVGITLDR
STSQNVLMVSTEGGMEIEKVAEETPEKLLKIQVNPLFGLQAFQARQAAFFLELEGEQFKN
TVKFITALYNAYTSIDAAIAEINPLVVTKEGRVLALDAKINFDSNALFRHKDFLELRDIS
EEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDMIQLAGGRPANFLDVGGGASPQ
TVEEGFKIILSDKNVKAILVNIFGGIVRCDRVAGGIIEAAKKVDLHLPVIVRLEGTNASI
AQKMLDESGLNLIAAKGLHDAAKKVHEALEPA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaatatcaaggcaaagatatcctgagaaaattcggtgtggcggttcca
aaaggcatcgtggcgttttcacctgaagaagctaaacaggccgctattcagctttttgaa
gagcagaacagccctgtcgtagtaattaaagctcaaatccatgcgggaggccgcggaaaa
gccggcggagtcaaactcgctaaatcccctgaggaggtctttgatattgcccagcaaatg
cttggcattacccttgtgacccaccagaccggacctgaaggtaaagaggttcgacgatta
ctcgttgaagaggggatgaacatcgataaagagttttatgtgggcattacccttgaccgc
tcaacatcgcaaaacgtgttgatggtttcaaccgaaggcggcatggaaatcgagaaagtc
gctgaagaaacaccggaaaaactcctgaaaatccaggtgaatcctctttttggattacag
gctttccaggcccgtcaggcagcgtttttccttgaacttgagggagagcaattcaaaaac
accgtcaagttcatcactgccctctacaacgcttacacctctattgatgcggctattgct
gaaatcaatcctcttgttgtcaccaaagagggacgcgttctggctcttgatgccaaaata
aacttcgactctaacgcattgttccgtcacaaggattttcttgaactgcgcgatatcagc
gaagaggatccgtttgaagtagaagcatctaaatccaatctcaattatgttcgtcttgac
ggaaacgtcggctgtatggtcaacggcgccggacttgcaatgggaaccatggatatgata
caacttgccggcggacgacccgcaaatttcctcgatgtgggaggtggagcaagcccgcaa
actgttgaagagggattcaaaatcattctgagcgataaaaatgtcaaggctattcttgtc
aacatttttggtggtattgtccgctgcgatcgcgttgccggaggcattatcgaggcggca
aaaaaagttgacctccatctgccggtaatcgtaaggcttgaaggaaccaatgcctcaatt
gcacagaagatgcttgacgaatcgggattgaacctcattgctgccaaagggcttcacgat
gcggcaaaaaaagtgcatgaagcgcttgagccggcataa

DBGET integrated database retrieval system