KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0623Help
Entry
Cpha266_0623      CDS       T00439                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00020  Citrate cycle (TCA cycle)
cph00640  Propanoate metabolism
cph00660  C5-Branched dibasic acid metabolism
cph00720  Carbon fixation pathways in prokaryotes
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
cph01120  Microbial metabolism in diverse environments
cph01130  Biosynthesis of antibiotics
cph01200  Carbon metabolism
Module
cph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cph_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
cph_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpha266_0623
   00640 Propanoate metabolism
    Cpha266_0623
   00660 C5-Branched dibasic acid metabolism
    Cpha266_0623
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpha266_0623
Enzymes [BR:cph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cpha266_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABL64678
JGI: Cpha2660623
UniProt: A1BE51
Position
complement(700083..701261)
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQGKDILRKFGVAVPKGIVAFSPEEAKQAAIQLFEEQNSPVVVIKAQIHAGGRGK
AGGVKLAKSPEEVFDIAQQMLGITLVTHQTGPEGKEVRRLLVEEGMNIDKEFYVGITLDR
STSQNVLMVSTEGGMEIEKVAEETPEKLLKIQVNPLFGLQAFQARQAAFFLELEGEQFKN
TVKFITALYNAYTSIDAAIAEINPLVVTKEGRVLALDAKINFDSNALFRHKDFLELRDIS
EEDPFEVEASKSNLNYVRLDGNVGCMVNGAGLAMGTMDMIQLAGGRPANFLDVGGGASPQ
TVEEGFKIILSDKNVKAILVNIFGGIVRCDRVAGGIIEAAKKVDLHLPVIVRLEGTNASI
AQKMLDESGLNLIAAKGLHDAAKKVHEALEPA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgaatatcaaggcaaagatatcctgagaaaattcggtgtggcggttcca
aaaggcatcgtggcgttttcacctgaagaagctaaacaggccgctattcagctttttgaa
gagcagaacagccctgtcgtagtaattaaagctcaaatccatgcgggaggccgcggaaaa
gccggcggagtcaaactcgctaaatcccctgaggaggtctttgatattgcccagcaaatg
cttggcattacccttgtgacccaccagaccggacctgaaggtaaagaggttcgacgatta
ctcgttgaagaggggatgaacatcgataaagagttttatgtgggcattacccttgaccgc
tcaacatcgcaaaacgtgttgatggtttcaaccgaaggcggcatggaaatcgagaaagtc
gctgaagaaacaccggaaaaactcctgaaaatccaggtgaatcctctttttggattacag
gctttccaggcccgtcaggcagcgtttttccttgaacttgagggagagcaattcaaaaac
accgtcaagttcatcactgccctctacaacgcttacacctctattgatgcggctattgct
gaaatcaatcctcttgttgtcaccaaagagggacgcgttctggctcttgatgccaaaata
aacttcgactctaacgcattgttccgtcacaaggattttcttgaactgcgcgatatcagc
gaagaggatccgtttgaagtagaagcatctaaatccaatctcaattatgttcgtcttgac
ggaaacgtcggctgtatggtcaacggcgccggacttgcaatgggaaccatggatatgata
caacttgccggcggacgacccgcaaatttcctcgatgtgggaggtggagcaagcccgcaa
actgttgaagagggattcaaaatcattctgagcgataaaaatgtcaaggctattcttgtc
aacatttttggtggtattgtccgctgcgatcgcgttgccggaggcattatcgaggcggca
aaaaaagttgacctccatctgccggtaatcgtaaggcttgaaggaaccaatgcctcaatt
gcacagaagatgcttgacgaatcgggattgaacctcattgctgccaaagggcttcacgat
gcggcaaaaaaagtgcatgaagcgcttgagccggcataa

DBGET integrated database retrieval system