KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0627Help
Entry
Cpha266_0627      CDS       T00439                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpha266_0627 (gpmA)
   01230 Biosynthesis of amino acids
    Cpha266_0627 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpha266_0627 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Cpha266_0627 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_0627 (gpmA)
Enzymes [BR:cph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cpha266_0627 (gpmA)
Exosome [BR:cph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cpha266_0627 (gpmA)
  Exosomal proteins of melanoma cells
   Cpha266_0627 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
704589..705332
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNRENRFTGWHDIDLTENGRNEAFQAGRLMKEAGLVFDMAYTSVLKR
AIRTLWNAMDSMDLMWISVFKSWRLNERHYGALQGLNKSETSRKYGEEQVLVWRRSYDTP
PPLLEKSDARYPGTDPRYGDLSEAEIPLSECLKDTVERFLPIWHETIAPQLRKGKRVIIV
AHGNSLRALVKYLDNISEEDIVGLNIPTGIPLVYELDDDLKPLKNYYLGDQEALKKAVDA
VAGQSKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctggtcttgttgcgacatggggaaagtcagtggaacagggaaaaccgattt
acaggatggcatgatattgatttgactgaaaatggccgaaacgaggcttttcaggctggt
cgactcatgaaagaagccggactggttttcgatatggcatatacctccgttttgaaaaga
gcaatcaggacgctctggaacgccatggattccatggacctcatgtggatttctgtgttc
aagagctggcgtctcaacgaacgccattatggtgctcttcaggggctcaacaagtcggaa
acttcccggaaatacggcgaggagcaggtgcttgtatggcgaagaagctatgatacgcct
ccgccgctgctcgaaaagagtgacgctcgttatcccggaaccgatccgcgttatggagac
ctctctgaagcggaaatccctctaagcgaatgtctcaaggataccgttgagcgttttctt
ccgatctggcatgaaaccatagctccgcaactgcgcaagggcaagcgtgtcattattgtc
gcacacggcaactcattacgtgctttagtgaaatatcttgataatatttccgaagaagat
attgtcggcttgaatatcccgacaggcattccgcttgtatacgagctcgatgatgatctc
aagcccttgaaaaactattaccttggggatcaggaagccttgaaaaaagctgtcgatgcc
gttgccggacagtcaaaagcgtag

DBGET integrated database retrieval system