KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0627Help
Entry
Cpha266_0627      CDS       T00439                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00010  Glycolysis / Gluconeogenesis
cph00260  Glycine, serine and threonine metabolism
cph00680  Methane metabolism
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
cph01120  Microbial metabolism in diverse environments
cph01130  Biosynthesis of antibiotics
cph01200  Carbon metabolism
cph01230  Biosynthesis of amino acids
Module
cph_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpha266_0627
  Energy metabolism
   00680 Methane metabolism
    Cpha266_0627
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_0627
Enzymes [BR:cph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cpha266_0627
Membrane trafficking [BR:cph04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cpha266_0627
Exosome [BR:cph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cpha266_0627
  Exosomal proteins of melanoma cells
   Cpha266_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABL64682
JGI: Cpha2660627
UniProt: A1BE55
Position
704589..705332
Genome map
AA seq 247 aa AA seqDB search
MIKLVLLRHGESQWNRENRFTGWHDIDLTENGRNEAFQAGRLMKEAGLVFDMAYTSVLKR
AIRTLWNAMDSMDLMWISVFKSWRLNERHYGALQGLNKSETSRKYGEEQVLVWRRSYDTP
PPLLEKSDARYPGTDPRYGDLSEAEIPLSECLKDTVERFLPIWHETIAPQLRKGKRVIIV
AHGNSLRALVKYLDNISEEDIVGLNIPTGIPLVYELDDDLKPLKNYYLGDQEALKKAVDA
VAGQSKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctggtcttgttgcgacatggggaaagtcagtggaacagggaaaaccgattt
acaggatggcatgatattgatttgactgaaaatggccgaaacgaggcttttcaggctggt
cgactcatgaaagaagccggactggttttcgatatggcatatacctccgttttgaaaaga
gcaatcaggacgctctggaacgccatggattccatggacctcatgtggatttctgtgttc
aagagctggcgtctcaacgaacgccattatggtgctcttcaggggctcaacaagtcggaa
acttcccggaaatacggcgaggagcaggtgcttgtatggcgaagaagctatgatacgcct
ccgccgctgctcgaaaagagtgacgctcgttatcccggaaccgatccgcgttatggagac
ctctctgaagcggaaatccctctaagcgaatgtctcaaggataccgttgagcgttttctt
ccgatctggcatgaaaccatagctccgcaactgcgcaagggcaagcgtgtcattattgtc
gcacacggcaactcattacgtgctttagtgaaatatcttgataatatttccgaagaagat
attgtcggcttgaatatcccgacaggcattccgcttgtatacgagctcgatgatgatctc
aagcccttgaaaaactattaccttggggatcaggaagccttgaaaaaagctgtcgatgcc
gttgccggacagtcaaaagcgtag

DBGET integrated database retrieval system