KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0801Help
Entry
Cpha266_0801      CDS       T00439                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cph01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cph00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
912494..913777
Genome map
AA seq 427 aa AA seqDB search
MLKIFCFAQDGEALKKQLSRSVSFDSGVQDVVNDILEQVRTRGDAALLEYTERFQGARLN
EMMVSGEEIRSAYEQVDSGFLEVMHEAYRNITRFHQHEVENSFFYEGAGGVILGQRVTPM
QRALLYVPGGMASYPSSLLMNAAPAKVAGVRDIVVTTPCDPDGRVNPHILAAAAVAGIDS
VYKLGGAQAIAAFAYGTESIPKVDIITGPGNKYVALAKKQVFGHVSIDSIAGPSEVVVIA
DETANPDFIVLDMFAQAEHDADASAVLITPSESLAAAVRETARRRIGSMLRKDIIGSALE
KNGAIVIVQSIEEACLVSDMIAPEHLELHVDRPWDLLPSINHAGAVFIGSYSCETVGDYF
AGPNHTLPTNGTARFFSPLSVRDFVKHTSIISYSKKQLQECGKKIAAFADYEGLQAHAEA
VRVRLDS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaaatattctgttttgcccaggatggtgaggctctgaaaaaacagttgagccgt
agcgtttcttttgattccggagttcaggatgtcgtcaatgatattcttgaacaggttcgc
acccggggtgacgcagcacttcttgagtataccgagcgctttcagggagcccggcttaat
gaaatgatggtttccggcgaagagatcagaagtgcttatgagcaggtggattccggattt
cttgaggtgatgcatgaggcctatcgcaatattacccgatttcaccagcacgaggtggaa
aacagttttttttatgaaggcgcggggggcgtaattctcggccagagggttactccgatg
cagcgggcactcctgtatgttcccggagggatggcctcttatccttcatcgctcttgatg
aatgctgcgcctgcaaaggttgccggcgtgagggatattgttgttaccaccccttgcgat
ccggatggacgtgtgaatccgcatattcttgcggctgccgcagttgccggaattgactct
gtttacaaacttggaggggctcaggcaatcgccgcgtttgcctatggtacggagagcatt
ccgaaagtggatattattaccggacctggtaacaagtatgttgcgcttgcaaaaaaacag
gtgtttggacatgtctccatcgacagcattgccggtccgtcagaagttgttgtgattgcc
gatgaaacagcaaacccggactttatcgttcttgatatgtttgcacaggcagagcatgat
gcggatgcttcggcggtgcttattactccatccgaatcgcttgcagcagccgttcgcgag
actgcccgccggaggatcggctcgatgctgcgcaaggatatcatcggttcagctcttgaa
aaaaacggcgctatcgtgatcgttcaatcaatagaggaggcctgtttggtgtcggatatg
attgcgccggaacatctcgaactgcatgtcgaccgtccatgggatctgctgccgagcatc
aatcatgccggggcagtgttcatagggagttactcctgtgaaacggtaggggattatttc
gcaggcccgaaccacacgcttccgaccaacgggacggcccgatttttttctccgctttct
gttcgtgattttgtcaagcacacctcaattatttcctactcaaaaaaacagcttcaggaa
tgtggtaaaaaaattgccgcatttgccgattatgagggtcttcaggctcatgctgaggct
gtccgcgtaagacttgattcgtga

DBGET integrated database retrieval system