KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0807Help
Entry
Cpha266_0807      CDS       T00439                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cpha266_0807
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cpha266_0807
Enzymes [BR:cph01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cpha266_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(919840..921114)
Genome map
AA seq 424 aa AA seqDB search
MDKLVIHGGRRISGTVAASGSKNSSLPIIAATLLAEKGTFTLHRIPELHDIETFTQLLQH
LGVETTFNNNTLRVSTENVQSILAPYELVKKMRASIYVLGPLLARFGEAKVSLPGGCAFG
PRPIDLHLMAMEKLGAEIKIETGFITASVKGKKLRGAHIDFPVSSVGATGNALMAAVLAK
GTTTITNAAAEPEIETLCHFLSAMGACIDGTGTTKLVIEGVATLQAIEFTNVFDRIEAAT
LLAAAAITGGSITLNGVEPSQLKAVLKKFVHAGCQISTQSDSVTLISPEQLLPTDVTAKP
YPSFPTDMQAQWIALMTQASGKSLITDRVYHERFNHIPELNRLGAHIEIKNNQAVVHGPR
KLSGTTVMSTDLRASASLVLAGLVAEGITEVLRVYHLDRGYEKIEMKLNALGAQISREKY
KEFS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcttgtcattcatggaggacgccgaatttcgggaacagttgctgcttcaggc
tcaaaaaactcttcccttcccatcattgccgcaacgctgcttgcagaaaaaggaaccttt
actcttcaccggattcctgaattgcatgatatcgaaacgttcacgcaactgcttcagcat
ctcggtgtagaaaccaccttcaacaacaatacgctcagggtttcaaccgaaaacgttcaa
agcatccttgctccttacgagctggtaaaaaaaatgcgggcatcgatctatgtgcttggc
ccgttgcttgcccgattcggagaagcaaaagtttcgctgccgggaggatgtgccttcggc
cctcgtcctatagaccttcacctgatggctatggaaaaactcggagctgaaataaaaata
gaaaccggctttattaccgcctcggtaaaaggcaaaaaacttcgtggcgcacacatcgat
tttcctgtttcatcagttggcgcaacaggaaatgctctgatggctgccgttctcgccaaa
ggtaccacgacaatcaccaatgctgctgccgagcctgaaatcgaaaccctctgtcatttt
ctctctgcaatgggagcctgcatcgatggaacgggaaccacgaaactcgtcatcgaaggg
gttgcaacgcttcaagccattgaattcaccaatgtattcgacaggatcgaggctgcaaca
cttcttgccgctgcggcaattaccggcggctcgatcacgctgaacggtgttgaaccctca
caacttaaagccgtcctgaaaaaatttgttcatgcaggctgccagataagcacacaaagc
gacagtgtaacccttataagccccgaacagcttctgcctaccgatgtaacagcaaaacct
tacccatcctttcccactgacatgcaggcacagtggattgccctcatgacccaggcgtca
ggaaaaagtctgattaccgacagggtttatcatgaacgtttcaatcacattcctgaactg
aaccggcttggtgcccatattgaaattaaaaacaatcaggctgttgttcacggaccccgc
aaactatcgggaacgaccgtcatgtcaaccgatttgagggcatcagcaagccttgtactt
gccggtctggttgccgaagggatcaccgaggtgctgcgcgtctatcatctcgaccgtggc
tatgaaaagattgaaatgaagctcaacgccctcggcgcacagatcagtcgggaaaaatac
aaggagttcagttga

  All links  
No link information was found.   
DBGET integrated database retrieval system