KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0838Help
Entry
Cpha266_0838      CDS       T00439                                 

Definition
recombinase D (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpha266_0838
Enzymes [BR:cph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cpha266_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(951556..953751)
Genome map
AA seq 731 aa AA seqDB search
MPEKTTPAPKHERISGSVERVTFYSEESGFSVLKVRVKGNRDLVSVVGTSPAISPGEFVE
CQGIWHNDRVHGLQFKAEHITVIPPTTASGIEKYLASGMVRGIGAFYAKTLVREFGARVL
DVIENTPEKLLDIPGIGKKRLDIITKSWAEQKAIRDIMVFLQSHGVGVARAFRIYKTYRE
DAIRLVTENPYRLSLDIEGVGFLTADTIADKLGISQDSLIRAEAGVRHMLQELATEGHCA
VPAERLIAESAAMLAVEVDIVTEAVKQQTEKKHLLCEEIDGRQCLYIAPLYRAERGVASG
LHRLMEGPLPWKEVNPDQSIGSVEQKTGLLLSPSQKEAVALVLKSKVSVITGGPGVGKTT
LVNVILSIISSLNVKVSLCAPTGRAAKRLSESTGLEAKTIHRLLEFDPILFNFKRGEGNK
LDTNLVVVDETSMVDVILMNKLLLAIPDKAALLLVGDVDQLPSVGPGAVLSDIITSGVIP
TVRLTEIFRQAAESSIIINAHQINQGKIPTNADGDALTDFYFIASTTPEDIHRKLLTMVT
ERIPKRFGFHPVRDIQVLTPMNRGGLGSRSLNIELQQALNKESMPQINRFGTTFSPGDKV
IQMVNNYDKEIFNGDIGLVVSINTDEGVLSVEYDRRVITYEFSELDEIALAYATSIHKSQ
GSEYPAVVIPLAMQHFTLLERNLLYTAVTRGKKLVVIIGQPKALATAVGNHRANQRLTNL
SRRLAECTETP
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaaaacgactcccgcgccaaagcatgaaaggatttccggctctgtcgagcgg
gtaaccttttacagcgaggagtccggattcagcgttctgaaggttcgggtgaaaggcaac
cgcgacctcgtatcggtggtgggaacttcaccggcaatctctcccggtgagtttgtagag
tgccagggcatatggcataacgaccgggtacacgggctccagttcaaggctgagcacatc
acggttattccgccaacaaccgcttcaggaatcgagaaatatcttgcatcggggatggtg
cgcggtattggcgctttttatgcaaaaacgcttgtcagggagttcggcgcaagagtactc
gatgttattgaaaacaccccggaaaagttactcgacattcccggcatcggaaaaaaacgc
ctcgacattatcacaaaatcgtgggccgaacaaaaagccattcgcgacatcatggttttt
ctgcagtcgcacggcgttggcgtagcaagagccttccggatatacaagacatacagggaa
gatgccatccgcctcgtaacggaaaatccctaccgcctttcgctcgatatcgagggagtc
gggtttctcaccgccgacaccatagccgataaactcggcatctctcaggactctctgatc
agggctgaagcgggcgtacgccacatgttgcaggaacttgccaccgaagggcactgtgcc
gtaccggcagaacgacttattgccgaatcggcagccatgcttgctgttgaagtcgatatt
gtcaccgaggcagtaaaacagcagacagaaaaaaaacatcttttgtgtgaagagatcgac
ggccgacagtgcctctacattgctccgctctaccgcgccgaacggggagttgcctcaggg
cttcaccgcctgatggagggcccccttccatggaaagaggtcaatcccgatcagagcatt
ggttcggttgagcaaaaaacaggcctgctgctctccccttcccagaaagaggcggtggct
ctggtactgaaaagcaaggtttccgtcataaccggcgggcccggtgtgggaaaaacaacg
ctggtcaacgttattctttccattatcagctccctgaatgtgaaggtctcgctttgcgct
ccaaccggacgcgcagcaaaacgcctgtcggaatcaaccggacttgaggcaaagacgatc
caccggctgcttgaatttgatccgatactgttcaacttcaaacgtggcgaaggcaacaag
ctcgatacaaaccttgttgtcgtggatgaaacatcgatggttgacgtgattctcatgaac
aaactgcttctggccattcccgacaaagcggcactgcttctggtcggggatgtcgatcaa
ttgccctctgtcggacccggcgcggtgctttcggatatcatcacttcaggagttatacca
acagtacgattgacagaaatcttccggcaggctgcggaatcgagcattattatcaatgcg
caccagatcaaccagggaaaaataccgacgaatgctgatggcgatgcgctgaccgacttc
tacttcattgcatcgacaacgccagaggatattcatagaaaactgctcaccatggtcaca
gaacgcattcctaaacgattcggctttcaccctgtaagagacattcaggtactgacgccg
atgaaccggggcggacttggatcacgctcgctcaatatcgaactgcaacaggcgctcaac
aaggagtcgatgccgcagattaaccggttcggaacgacattctcgcccggcgacaaggtt
atccagatggtaaacaactatgacaaggagatttttaatggcgatatcggtcttgtcgta
tcaataaataccgatgaaggagtcctctctgttgaatacgaccgtcgggtgattacctat
gagttttcggaactcgatgaaatagctcttgcctacgccaccagcatccacaaaagtcag
ggatcagaatacccggctgtcgtcataccgcttgccatgcagcacttcacgctgcttgaa
agaaatctgctctacacagcggtaacacgaggcaaaaaactcgttgtcatcatcggtcag
cctaaagcacttgcaactgctgtagggaaccatagagcgaaccagcgcctgaccaacctt
tcgagaaggcttgctgaatgcacagaaaccccatga

DBGET integrated database retrieval system