KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0934Help
Entry
Cpha266_0934      CDS       T00439                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Brite
Enzymes [BR:cph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Cpha266_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1073528..1076647
Genome map
AA seq 1039 aa AA seqDB search
MSDQNPILNSPYEEPLLHYATDEDGALNYSDIRSGRRIFTPDIQPIPTRQGDQGSIFEIN
DYAVAFGDYPVNLLRNEVGKWREALYPGTTRVTRELLSFWFLNPERHAVRKLFFAQREAV
ETAIWLNEIGEKSNTGHFIVTRLIAAQCDVSTNREQQLPRIAFKMATGSGKTVVMGMLML
YHYFNRQEYRQDTRFADYFLIVTPGITIRDRLGVLFVDKRSANKHDRVDYYAARDLVPQT
LEPRLEGLNARLIITNYHALEPKTLQGNKKSPLDGKLDVFGNKQEAKEDFSLLIKRLLGR
FKTGSRLLVLNDEAHHCYLPKSKGKTEDNEESDENAKAAVWFTGITEISKRYKLQQVYDL
SATPYYLKGSGYDAYTLFPWVVSDFGLIEAIESGLVKIPFIPESDNTQELDTPVLRNLYE
HVRDDLPKKGRKRAKSDAKKEGSDVKEAPPKLPRLVKGALDQFYNHYREYDEGSRISHEE
RSGLFSTPPVFIVVCNNTSVSKEVYKFIAGYEERDSEGNVTRVVDGHYSLFSNYDPDTRM
AKHRSPTLLIDSDALENSDQISDEFKKIFASEIAEFKRDYARLKGQGSIETITDAEILRE
VVNTVGKRGRKLGSHIRCVVSVSMLSEGWDANTVTHIMGLRAFGSQLLCEQVAGRALRRM
NYFLQTYRRDSGELVAEKDRHRFRKENLIEKFPPEYAHIIGVPFTMFKSGKTTNPDPPDY
THIKALPERQNDFEITFPNLIGYRTEQLDGNILHDFSGIENYELDFSKFPTETTLASPFS
PHQEKMQITSVLEKRDQELLFLITNELIRTHFSDEDQNPRFQLFGKLKAIVEEWYKSKVV
LLNQQDERYKRLLYFEEGKKMADHIVRAINPHINTEEYIRPVFNYYNRFGSTKYVSGNTS
KEVYRATKSHVNYVAMDSGWEGIAAKTLEELPQVISYVKNQFLGFTVPYVKEGQDKQYYP
DFIALIATPAGEPLNLIIEISGMSKDKAEKKWFVENRWLPAVNAVHEKYEFGRWHFIEVA
NDIRDIRTQLLNKIQEINL
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccaaaaccccattctcaacagtccttacgaagagcccctgcttcactatgcc
acggatgaagatggagcgctgaactacagcgacatccgttccgggcgcagaatattcact
cccgatatccagccgattccgacccggcaaggtgatcagggttcaatcttcgagattaac
gattacgctgttgcgtttggcgactatccggtcaatcttctccgcaacgaggtaggtaaa
tggcgtgaagccctctatccgggcacaacaagagtgacaagggagctgctctcgttctgg
ttcctgaatcctgaacgtcatgcggtcagaaaactcttttttgcccagagagaagctgtt
gaaactgcaatctggctgaatgaaattggcgaaaaaagcaataccggtcacttcattgtt
accaggctgattgctgctcagtgtgacgtcagcaccaacagagagcaacagttaccaaga
attgcctttaaaatggctaccggcagcggtaaaacggtggtgatgggaatgctgatgctc
tatcactactttaaccgtcaggagtaccggcaggatacccgctttgccgattatttcctg
atcgtcacacccggaatcactatcagggatcgccttggtgtgttgtttgtcgataaacgc
tctgccaacaagcatgatcgggtggactactatgcagcacgtgatcttgtgccgcaaacg
cttgagccacggcttgagggactgaacgcacgattgatcattacgaactatcatgcattg
gaacccaaaaccctccagggaaacaagaagagcccgttggacggcaagctcgatgttttc
gggaataaacaggaggcaaaagaggatttcagtctgctcatcaaacgcctgcttggccgt
ttcaaaacagggagtcggctgcttgttttgaatgacgaggctcatcactgctatctgcca
aaatcgaaaggcaaaacagaggacaacgaagagtcggatgaaaatgccaaagcggctgtc
tggtttaccgggatcaccgaaatctccaaacgctacaagcttcagcaggtttacgatcta
tcggcaactccctactatctgaaaggttccggatatgatgcctacactctttttccctgg
gtcgtcagtgatttcggtctgatcgaagcgattgagtccggtctggtcaaaattcccttt
attcccgaaagcgacaacacgcaggagcttgacacaccggtactccgcaacctttatgag
cacgtcagggatgatttgccaaaaaaagggcgcaaacgggccaaatcagatgcaaaaaaa
gaaggttcggacgtcaaggaagctcctccgaaactgccccggctggttaaaggggcactt
gaccagttttataaccactacagggagtatgacgaaggaagccgcatcagccatgaagag
cggagcggactgttcagtacaccacctgtttttattgtggtctgcaacaacacctccgtt
tcaaaggaggtttacaaatttattgccgggtacgaagagcgtgacagcgagggcaatgtg
acgagagtggttgatggccattactccctgttttccaactacgatccggatacaaggatg
gccaaacaccggtcacccacgctgcttatcgacagtgacgcacttgagaattctgaccag
atcagtgacgagttcaaaaaaattttcgcttccgaaattgccgagttcaagcgtgactat
gcccgtctcaagggacaggggtctattgaaacgataaccgatgcagaaattctgcgtgaa
gtggtcaacacggtcggcaagcgaggaagaaagctcggttcccatattcgctgcgtggtt
tcggtctccatgctttccgaagggtgggatgccaacacggtaacacatatcatgggtctc
agagcctttggttcacagttgttgtgcgaacaggtagcgggtcgtgcactgcgcaggatg
aactacttccttcagacctacaggagagatagtggagagcttgttgcagaaaaagatcgt
caccgtttcaggaaggaaaaccttatcgaaaaatttcctccggaatatgcccacatcatc
ggcgtaccatttaccatgttcaaatccggcaagacgaccaatcccgatccgcccgactat
acccacatcaaggcgcttccagagcgccagaacgatttcgaaatcacattcccgaacctg
atcggataccgcactgagcagcttgatggcaacatcctgcatgacttttccggaatcgag
aactatgaactcgatttttcaaaattccctaccgagaccacgcttgcaagcccgttttcc
ccacatcaggaaaaaatgcagatcacctctgttctcgaaaaacgggatcaggaactgctt
tttctcattaccaacgaactcattcgtacccacttttcagatgaagaccagaacccccgc
ttccagttgttcggcaagctgaaagctattgtcgaagagtggtacaagagcaaagtggtt
ctgctcaaccagcaggacgagcgttacaaacgcctgctctactttgaagagggaaaaaag
atggcagaccacattgttcgtgccattaacccgcacatcaacaccgaagagtacatccgt
cctgttttcaactactacaaccggtttggcagtacaaaatatgtcagtggcaacacctca
aaagaggtgtaccgcgcaacaaaaagccatgtcaactatgtcgccatggacagcggctgg
gaaggtattgcagccaaaaccctcgaagagttgccgcaggttatcagctatgtcaagaac
cagttcctcggctttaccgtgccttatgtcaaggagggtcaggacaaacagtactatcct
gactttatcgccctgatagcaaccccggcaggagaaccgctcaacctcattattgaaatc
agcggcatgagcaaagacaaggcagaaaagaaatggtttgtcgaaaaccgctggcttcct
gccgtcaacgccgtgcatgaaaagtacgaatttggccgatggcacttcatcgaagtagcc
aacgacatccgcgacatcaggacacagttgctcaataaaattcaggaaataaacttatag

DBGET integrated database retrieval system