KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_0976Help
Entry
Cpha266_0976      CDS       T00439                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00790  Folate biosynthesis
cph01100  Metabolic pathways
Module
cph_M00843  L-threo-Tetrahydrobiopterin biosynthesis, GTP => L-threo-BH4
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cpha266_0976
Enzymes [BR:cph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cpha266_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: ABL65024
JGI: Cpha2660976
UniProt: A1BF47
Position
complement(1118466..1119125)
Genome map
AA seq 219 aa AA seqDB search
MPSDISVSKTPSSLNSGGFCEDDECLMDGDTASPEEISNLSGAVSMLLQGIGENPDREGL
LKTPERVARSMRFLTRGYRQNPEELLKKAVFTESYDEMVLVRDIDIFSMCEHHLLPFFGK
AHVAYIPDGKIVGLSKIGRVVEVFARRLQVQERLTQQIRDAIQDVLNPKGVAVVIEAKHL
CMVMRGVEKLNSVTTTSAMSGEFISSPSTRSEFLRLIGA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcagatatctcggtcagtaaaactccgtcatccttaaattccggaggattttgt
gaagatgatgagtgcctcatggatggtgatacggccagtccggaagagataagcaatctt
tcaggagcggtttcgatgctccttcaggggatcggcgagaatcctgatcgtgaagggttg
ctcaaaacccccgaacgtgtcgctcgatcaatgcgtttccttacacgcggctacagacag
aatcccgaagaactccttaaaaaagcagtattcacagaatcgtacgatgaaatggtactg
gtccgggatatcgacatcttttcgatgtgcgaacaccatcttcttccgtttttcggtaaa
gcgcatgtcgcttacatccctgacggtaaaattgtaggcctttcaaaaatcggcagggtc
gtcgaagtctttgcaaggagacttcaggtacaggaacgcctcacccagcagattcgcgat
gccattcaggatgttctcaaccctaaaggcgttgctgttgtcattgaagcaaaacacctc
tgcatggtcatgcgaggggtagaaaaactgaattcggttacaaccacctctgcgatgtcc
ggtgaatttatctcttcaccatccactcgaagcgagtttttacgtcttatcggtgcctga

DBGET integrated database retrieval system