KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1307Help
Entry
Cpha266_1307      CDS       T00439                                 

Definition
ATP citrate lyase subunit 1 (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpha266_1307
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpha266_1307
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpha266_1307
Enzymes [BR:cph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Cpha266_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1498985..1500181)
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPERLAQLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKLGLNLEEALEASREMIGRKIGTAVVRQVIVAEMLEHDEEYYVSIAGNRDGAELLL
STKGGVDIEDNWDTVKRLFIPMDETPSVERLTEVAAEAGFTGEVAERVAKIAARLILCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNVDYDARFRHADWDFKPVSEIGRPYTEAEQQI
MEIDARIKGSVKFVEVPGGEIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPPDWAV
EALTETICRLPKIRHIIVGGAIANFTDVKATFSGIINGLRESRSKGYLQNVTIWVRRGGP
NENQGLAAIRKLQDEGFDIHVYDRSMPMTDIVDLAMNS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggcctgccatgaagcttttcaacaagtggggcattccggtg
ccgaactatgttgtaatcatggaccctgaacgccttgcgcagctcggggaagctaataaa
tggctgcgagaatcaaaacttgttgttaaagcccacgaggctattggcggcagattcaag
ctcggtctcgttaagctcggactgaatcttgaggaggcgcttgaggcttcccgcgagatg
attggccgaaagatcggtacggctgttgtgcgtcaggttattgttgcagaaatgcttgag
catgatgaagagtactatgtttcgattgccggaaaccgcgacggcgcggaacttctgctt
tcgacaaagggcggcgttgatatcgaagataactgggataccgtcaagcgtctctttatt
cccatggatgaaacaccgagtgtcgaacgtcttacagaggttgccgctgaggccggtttt
actggcgaagttgccgaacgagtcgcaaaaatcgctgcgcgcctgattctctgttttgat
aatgaagatgcgcaatccatcgaaatcaatcctctcgttattcgcaaaagcgacatgcgt
tttgccgctcttgatgcggtgatgaatgttgactacgatgcccggttccgtcatgctgac
tgggatttcaaaccggtctccgaaatagggcgcccctataccgaggctgaacagcagatc
atggagatcgatgcaagaataaagggatcagtcaagtttgttgaagttcccggtggcgaa
atcgccctcctgaccgctggcggcggtgcttcagtattctactccgacgctgttgttgca
agaggaggaactattgccaattatgccgaatattcaggtgatcctccggattgggcagtt
gaggcgcttacggaaacgatttgtcgtttaccgaaaatccgtcatatcatcgttggtggt
gccatagcaaatttcacggacgttaaggctaccttcagcggtattataaacggtctgcgc
gaaagccgctcgaaaggctaccttcaaaatgtcacaatctgggtacgtcgaggcgggccg
aatgaaaatcagggtcttgcggctatccggaaactgcaggatgagggttttgatatccat
gtgtatgaccgcagtatgccaatgaccgacattgtcgatcttgccatgaactcatag

DBGET integrated database retrieval system