KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1307Help
Entry
Cpha266_1307      CDS       T00439                                 

Definition
(GenBank) ATP citrate lyase subunit 1
  KO
K15231  ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00020  Citrate cycle (TCA cycle)
cph00720  Carbon fixation pathways in prokaryotes
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
cph01120  Microbial metabolism in diverse environments
cph01130  Biosynthesis of antibiotics
cph01200  Carbon metabolism
Module
cph_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
cph_M00614  Anoxygenic photosynthesis in green sulfur bacteria
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpha266_1307
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Cpha266_1307
Enzymes [BR:cph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Cpha266_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_bind ATP-grasp_2 ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABL65338
JGI: Cpha2661307
UniProt: A1BG11
Position
complement(1498985..1500181)
Genome map
AA seq 398 aa AA seqDB search
MAKILEGPAMKLFNKWGIPVPNYVVIMDPERLAQLGEANKWLRESKLVVKAHEAIGGRFK
LGLVKLGLNLEEALEASREMIGRKIGTAVVRQVIVAEMLEHDEEYYVSIAGNRDGAELLL
STKGGVDIEDNWDTVKRLFIPMDETPSVERLTEVAAEAGFTGEVAERVAKIAARLILCFD
NEDAQSIEINPLVIRKSDMRFAALDAVMNVDYDARFRHADWDFKPVSEIGRPYTEAEQQI
MEIDARIKGSVKFVEVPGGEIALLTAGGGASVFYSDAVVARGGTIANYAEYSGDPPDWAV
EALTETICRLPKIRHIIVGGAIANFTDVKATFSGIINGLRESRSKGYLQNVTIWVRRGGP
NENQGLAAIRKLQDEGFDIHVYDRSMPMTDIVDLAMNS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatacttgaagggcctgccatgaagcttttcaacaagtggggcattccggtg
ccgaactatgttgtaatcatggaccctgaacgccttgcgcagctcggggaagctaataaa
tggctgcgagaatcaaaacttgttgttaaagcccacgaggctattggcggcagattcaag
ctcggtctcgttaagctcggactgaatcttgaggaggcgcttgaggcttcccgcgagatg
attggccgaaagatcggtacggctgttgtgcgtcaggttattgttgcagaaatgcttgag
catgatgaagagtactatgtttcgattgccggaaaccgcgacggcgcggaacttctgctt
tcgacaaagggcggcgttgatatcgaagataactgggataccgtcaagcgtctctttatt
cccatggatgaaacaccgagtgtcgaacgtcttacagaggttgccgctgaggccggtttt
actggcgaagttgccgaacgagtcgcaaaaatcgctgcgcgcctgattctctgttttgat
aatgaagatgcgcaatccatcgaaatcaatcctctcgttattcgcaaaagcgacatgcgt
tttgccgctcttgatgcggtgatgaatgttgactacgatgcccggttccgtcatgctgac
tgggatttcaaaccggtctccgaaatagggcgcccctataccgaggctgaacagcagatc
atggagatcgatgcaagaataaagggatcagtcaagtttgttgaagttcccggtggcgaa
atcgccctcctgaccgctggcggcggtgcttcagtattctactccgacgctgttgttgca
agaggaggaactattgccaattatgccgaatattcaggtgatcctccggattgggcagtt
gaggcgcttacggaaacgatttgtcgtttaccgaaaatccgtcatatcatcgttggtggt
gccatagcaaatttcacggacgttaaggctaccttcagcggtattataaacggtctgcgc
gaaagccgctcgaaaggctaccttcaaaatgtcacaatctgggtacgtcgaggcgggccg
aatgaaaatcagggtcttgcggctatccggaaactgcaggatgagggttttgatatccat
gtgtatgaccgcagtatgccaatgaccgacattgtcgatcttgccatgaactcatag

DBGET integrated database retrieval system