KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1353Help
Entry
Cpha266_1353      CDS       T00439                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Brite
Enzymes [BR:cph01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Cpha266_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1546382..1547437
Genome map
AA seq 351 aa AA seqDB search
MKIHSIAAGVLVIGVMASCAKAPPPVNEPLPVEQPKTPVLQPKTNEPIQPVEDAKVTDPA
MVELGKQLFFDPRLSKSGFISCNSCHNLSMGGSDNLKSSIGHKWNKGPINSPTVLNSSMN
LAQFWDGRAKDLKEQAGGPIANPGEMAFTHELAIEVLQSIPGYAEEFKKVFGVDKIDIDQ
ITRAIAAFEETLVTPNSRFDKWLKGDDAAITQNEREGYELFKSSGCTACHNGPALGGNSY
QKMGVVEPYKGSTNAVGRSAVTGKDADRFNFKVPTLRNIELTYPYFHDGEAATMAKAVEV
MGQIQLGKTFTPDENAKIVAFLKSLTGDQPKFVLPLLPPSSDTTPPPAPFK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcactccatcgctgcaggcgtactggttatcggagtaatggcttcctgcgcg
aaagcccctccccccgtaaatgaaccgctgccggttgagcaacctaaaaccccggtgctt
caaccaaaaacaaacgaacccatccagcctgttgaggatgcaaaagtcaccgatcctgcc
atggtggaacttggaaaacagcttttctttgatccccgactctcaaaatccggatttatc
tcctgtaactcgtgccataatctcagcatgggtggcagtgacaacctgaaatcctcaatc
ggccacaaatggaacaaaggcccgatcaactctccaaccgtgctgaactcctccatgaac
ctcgcgcaattctgggacggcagagcaaaagacctcaaggagcaggcgggagggcctata
gccaaccccggcgaaatggcatttacccacgaacttgccattgaagtgctccagtccatt
cctgggtatgcagaggaattcaaaaaggtttttggcgtcgacaagatcgatatcgatcag
atcactcgtgccattgccgcatttgaggaaacgctggttacgccgaactcccgattcgac
aaatggcttaaaggtgacgatgccgccatcactcagaacgaacgtgaaggatatgagctg
tttaaatcaagcggatgcacagcctgccacaacggcccggcccttggcggcaactcctat
cagaaaatgggtgtcgttgaaccttacaagggaagcaccaatgccgtaggtcgatccgcc
gttacaggcaaagatgctgaccgcttcaatttcaaagtaccgacactgcgcaatattgaa
ctgacctatccctacttccatgacggggaagcggcaaccatggcaaaagccgttgaagta
atgggccagattcagttgggaaaaacatttactcctgatgaaaacgcaaaaatcgtcgcc
ttcctgaaaagcctgacaggcgatcaaccaaaattcgtactgccgcttcttccgccatca
tctgatacaacgccaccaccggcgccattcaaataa

DBGET integrated database retrieval system