KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1400Help
Entry
Cpha266_1400      CDS       T00439                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpha266_1400
Enzymes [BR:cph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cpha266_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1590428..1592173)
Genome map
AA seq 581 aa AA seqDB search
MSIEFCQRSIDRQIAEYLCRGARDEPGVLVRSVVSLLSQAVGQGHVCLDLEEIAGEVVRI
PGREEPLRLPGIVNLLAALRSLPTVGRPGEHRPLILDEAGRLYLYRYFRYELQLAEAIRA
RAAMETGSPDEAALAEQLDRYFVPDESGEDRQRQAALTALRRGFSVISGGPGTGKTTTVV
RILGLLLEQTGGERMRIAMAAPTGKAAARLASSIASLRESLPCTEEVKHTVPSQVTTIHR
LLGTIPNSTGFRHNARNPLPYDAVIVDEASMVDLPLMTALVTALMPQARLILIGDRDQLA
SVEAGAVLGDICRAAESPGSAVSSIKGCVTVLDRNYRFGDGSGIAALSRAINSGDAGEAI
RLLGDPADSTISLEATPMREAVRKRLASPVLEGFRPYLEAEAPEDALRLFERFRILTALR
EGPWGAAGMNHAVETLLHEAGLLKADTPFYRGRPVLVTENDYIHKLFNGDTGIILPDPET
GNQKAYFAAPDGTVRSIPPEFLPAHVTAFAMTVHKSQGSEFDRVLMVLPPEDTLLLTREL
IYTGITRARQAITLWSDEAVFSAAVKRRTERRSGLRERLVL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgagttttgccagcgatccatagaccgccagatagcggaatatctctgccgt
ggagcaagggacgaaccgggagtgttggtgcgctcggtagtttcgctgctcagccaggcg
gtagggcaggggcacgtctgcctcgacctcgaagagattgccggagaggttgtgcggatt
ccgggccgggaggaaccgctgcgcctgccgggtatcgtaaacctgctcgcagcgctccgt
tcgctgccaacagtcggcaggccgggtgagcatcgcccgctgatcctcgacgaagccgga
cggctctacctttatcgttacttccgctacgaactccagcttgccgaagccattcgcgcc
cgtgctgcaatggagactggcagccccgacgaagccgcgcttgccgaacagctcgaccgc
tacttcgtccccgatgaatcgggagaggatcgccaacgtcaggccgctctcacggcgctc
cggagaggcttctcggtcatctccggcggccccggtaccggcaagaccaccaccgtggtg
cgcattctcggacttctgctggaacagacaggcggagagcggatgcgcatcgccatggcc
gcgccaacgggaaaggccgccgcacggcttgcctcctctatcgcttcgctccgggagtcg
ttgccctgtaccgaagaggtgaagcacaccgtccccagccaggtcaccaccatccaccgg
ctgctcggcaccatccccaattcgaccgggttccggcataacgcccggaatccgctcccg
tacgacgccgtcatcgtcgatgaagcctcgatggtcgatctgccgctcatgaccgccctc
gtcacggcgctcatgccgcaggcccgtctcatcctcatcggcgaccgcgaccagctcgcc
tccgtcgaagccggagccgtgctcggcgacatctgtcgtgccgcagaatctcccggctcc
gcagtttcttccatcaaagggtgcgtcaccgtgctcgaccgcaactaccgcttcggcgac
ggttccggtatcgcagccctcagccgggccatcaacagcggagacgccggcgaagccatt
cgtcttcttggcgacccggccgacagcaccatctcgctcgaagccacaccgatgcgtgaa
gccgtcaggaagcgcctcgcaagcccggtgcttgaaggcttccgcccctatctcgaagca
gaagcgccggaagatgccctgcgccttttcgagcgcttccgcatactcaccgcactccgc
gaaggcccctggggagccgcaggcatgaaccacgccgtcgaaaccctgctccacgaagcg
ggactcctcaaggccgacaccccgttctaccggggcagaccggttctcgtcaccgaaaac
gactacatccacaaactctttaacggcgacaccggcatcatcctccccgacccggaaacc
ggcaaccagaaagcatatttcgccgcccccgacggcaccgtccgctccatccccccggag
ttcctcccggcgcacgtaaccgctttcgccatgaccgtgcacaaaagccagggttcggag
ttcgacagggtgctcatggttctgccgcctgaggatacgcttcttctgacgagagaactg
atctatacaggtattacgagagcacggcaggccattacgctctggagcgatgaagctgtt
ttcagcgcagcggtaaagcgcagaacggagcggagaagcgggttgagggagaggcttgtt
ttatag

DBGET integrated database retrieval system