KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1630Help
Entry
Cpha266_1630      CDS       T00439                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cph00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1856541..1858400)
Genome map
AA seq 619 aa AA seqDB search
MIAFTDIVGMDLAKQALMLLAVDSSLGGVVIPSAVGSGKSTLARAFAGILPEDTPFVELP
LNVTEDRLIGGVDLEATLASGVRVVQHGVLSKAHGGVLYVDSLSLLDSSAVSHIMDAMSR
GEVLVEREGLSEVHPASFMLVGTYDPTDGDVRMGLLDRVGIIVPFTAQNDYRARKKIVTT
VLGKRDEEDTRDELKMLAGLVQAAREQLKHVSITKEQVQALIQTALSLGVEGNRADIFTI
RAALASAALAQRSDVEDEDMKLAIKLVLIPRATRMPEREPAEDEMPPEQEPPPPDEEPEA
EDESAQDDTPDADAEEEQKDTPDMIEELMMEAVETELPDNILNISLASKKKSRSGSRGEA
LNNRRGRFVRAQPGEMRSGKVALIPTLISAAPWQETRRRDKKMAGRPKTALIITKDDVKI
KRFRDKSGTLFIFMVDASGSMALNRMRQAKGAVASLLQNAYVHRDQVALISFRGKQAQVL
LPPSQSVDRAKRELDVLPTGGGTPLASALFLGWETAKQARTKGITQVMFVLITDGRGNIG
LQAAFDPNAEKAPKELLEKEIEALSLSIQADGVAAIVIDTQMNYLSRGEAPKLAQQLGGR
YFYLPNAKADQIVEAALSF
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatagcgtttaccgacattgtaggaatggatctggcaaagcaggcactgatgctgctt
gccgttgattcatcgcttggaggtgttgttatcccttcagcagtaggttcaggaaagtca
acgcttgcaagggcatttgccggtattcttccagaggacaccccttttgttgaacttcct
ctcaacgttaccgaggatcgtcttattggcggcgttgatcttgaggcgacattggcgtcc
ggagttcgcgttgtacagcacggagtgctctcgaaagcgcatggcggagtactctatgtt
gattcgctcagtcttctcgacagttcggcagtatcgcatatcatggatgccatgtcgcgc
ggcgaggtgctggtagaacgtgaagggctcagcgaggtgcatccggcatcgtttatgctg
gtgggtacctacgatcccacggatggggatgttcgtatgggtcttctcgacagggtcggt
attattgttccttttaccgcccagaacgattaccgtgcccggaagaaaattgtcacgacg
gtgcttggcaagcgggacgaggaagacactcgtgatgaactgaaaatgcttgccggtctc
gttcaggctgctcgtgagcagctcaagcacgtttcaatcaccaaagaacaggttcaggcg
cttattcagaccgcgctcagccttggcgttgagggtaatcgtgccgatatctttacgata
cgggcagcccttgcaagcgccgcgcttgctcagcggagcgatgtcgaggacgaggatatg
aagcttgccatcaagcttgtgctgattcctcgcgctacacggatgcccgagcgcgaacca
gcagaagatgagatgcctccggagcaagagcctccgccgccggatgaagaaccggaagct
gaggatgaaagcgcgcaggatgatactcccgatgccgacgccgaagaggaacagaaagat
acccccgacatgatcgaagagctcatgatggaggctgtagaaaccgagcttccggataat
attttgaatatctcgctcgcatcgaaaaagaaaagccgctcaggaagtcgtggtgaggcg
ctgaacaaccggcgaggtcgttttgttcgggctcaacccggagagatgcgcagtggaaag
gttgcgcttattcctacgcttatttctgcggctccgtggcaggagacacggcgtcgggat
aaaaaaatggcaggccgtccgaaaaccgccctgatcatcaccaaggatgatgtaaagatc
aagcggttccgtgacaaatccggtacgcttttcatatttatggttgatgcttcaggatca
atggctttaaaccgtatgcgtcaggccaagggagcggttgcaagccttctgcagaatgcc
tatgtgcatcgtgaccaggttgccctgatctcgttcagaggcaagcaggctcaggtgctg
ctgcctccgtcccagagcgttgatcgtgccaagcgggagcttgatgttctgcctacaggt
ggcggaacaccgcttgcttcagcgctttttctcggctgggaaactgccaagcaggcacgc
acaaaaggaataacccaggtgatgtttgtcttgatcactgacggcaggggcaatataggg
ttgcaggcagccttcgatccgaatgccgaaaaagctcccaaggagctgcttgaaaaagag
attgaagcgctttcgctttccattcaggctgacggcgtagccgctatcgtcatcgatacg
cagatgaactatctatcaagaggtgaggcgcccaagctcgcccagcagcttggcgggcgt
tatttttaccttccaaacgcaaaggcagatcaaattgttgaggccgctctcagcttctga

DBGET integrated database retrieval system