KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1778Help
Entry
Cpha266_1778      CDS       T00439                                 

Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:cph00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2022533..2023813
Genome map
AA seq 426 aa AA seqDB search
MILTIYSTVTPLLYRAVSIASFFHPKLRTFFTVRQGTLDALEKKINALPKPVFRIWIHAA
SVGEFEQARPIVSAMKKAQPDIDVVVSFLSTSGYQTRKNYPDASAVFYLPIDTKSNARRL
IEILKPDALLVMRYDFWPNHLIAAKKHGTALILAAAVLQKNSPYFKPLVKTFYHSVFALF
DKIYTSSSRDTESFREVFRCKNTETAGDPRFDQVLLRSRNTQRVAHLSPLFAHHTVLVAG
SVWKQDELVLLPAWQELKHRPSLIMVPHETDHDNLERLSRHLTQCNISFSKVSEGIEHFD
AINQVLIIDETGYLAELYSIASIAYVGGGFGINVHNTIEPAAYGIPVLFGSRHHNSPEAE
NLVECGGAAVVHNSAELREKLAFLTANKENRMRMGELAGTFVTSRIGATKKIADYILEQK
RTRNDR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgatcttaactatttacagcacagtcacccctcttctgtaccgtgcggttagcattgcg
agcttttttcacccaaaactgcgaacatttttcactgtccgtcaaggcacgcttgatgct
cttgaaaaaaaaataaacgcactgccaaagccggttttcagaatctggatccatgcggca
tcagtcggagagttcgaacaggcgcgtccgattgtgtcggcaatgaagaaagcgcaaccg
gatattgatgtcgttgtctctttcctctcaacatcgggttatcaaaccagaaaaaattac
ccggatgcttcggcagtattttatctcccgattgacaccaaatcaaacgctcgccgtctt
atcgagatcctcaaacctgacgcactgctcgtcatgcgatatgacttctggccaaaccat
ctgatagccgcgaaaaaacacggaaccgccctgattcttgccgctgcggtactccaaaaa
aactcaccttacttcaaacctctcgttaaaacattttatcactcggttttcgcacttttc
gataagatatatacaagctcctcacgcgacaccgaatcattcagggaggttttccgatgc
aagaacacagaaacagccggagacccccgttttgaccaggtgcttctgcgaagccgcaat
acccaaagagttgcccatctttcgcctcttttcgcacatcataccgtactcgttgcagga
agcgtctggaagcaggatgaactggtcctcctgcctgcctggcaagagctgaaacatcgc
ccgtctcttatcatggtaccccatgagacagatcatgataacctggaacgactatcccgg
caccttacccaatgcaacatctccttttcaaaagtttccgaaggtattgagcattttgat
gcgataaaccaggtacttatcattgacgaaacaggataccttgcagaactatactcaatt
gcttcgatagcctatgtcgggggggggtttggaattaatgtccacaacaccatagagccg
gcagcatacggcattccggtgcttttcgggtcccgacaccacaactcgccggaagcggaa
aatctcgttgagtgcggaggagctgccgtcgtacacaacagtgcagaactcagggaaaaa
cttgcgtttctcaccgcaaacaaggagaacagaatgcgcatgggtgaacttgcgggtacc
tttgtaacaagccgtatcggagctacgaaaaaaattgccgactatatcctggaacagaag
cgcacacgtaacgacagataa

DBGET integrated database retrieval system