KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1778Help
Entry
Cpha266_1778      CDS       T00439                                 

Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Cpha266_1778
Enzymes [BR:cph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.12  lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     Cpha266_1778
    2.4.99.13  (Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase
     Cpha266_1778
    2.4.99.14  (Kdo)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase
     Cpha266_1778
    2.4.99.15  (Kdo)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase
     Cpha266_1778
Glycosyltransferases [BR:cph01003]
 Polysaccharide
  Bacterial polysaccharide
   Cpha266_1778
Lipopolysaccharide biosynthesis proteins [BR:cph01005]
 Core region
  Cpha266_1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2022533..2023813
Genome map
AA seq 426 aa AA seqDB search
MILTIYSTVTPLLYRAVSIASFFHPKLRTFFTVRQGTLDALEKKINALPKPVFRIWIHAA
SVGEFEQARPIVSAMKKAQPDIDVVVSFLSTSGYQTRKNYPDASAVFYLPIDTKSNARRL
IEILKPDALLVMRYDFWPNHLIAAKKHGTALILAAAVLQKNSPYFKPLVKTFYHSVFALF
DKIYTSSSRDTESFREVFRCKNTETAGDPRFDQVLLRSRNTQRVAHLSPLFAHHTVLVAG
SVWKQDELVLLPAWQELKHRPSLIMVPHETDHDNLERLSRHLTQCNISFSKVSEGIEHFD
AINQVLIIDETGYLAELYSIASIAYVGGGFGINVHNTIEPAAYGIPVLFGSRHHNSPEAE
NLVECGGAAVVHNSAELREKLAFLTANKENRMRMGELAGTFVTSRIGATKKIADYILEQK
RTRNDR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgatcttaactatttacagcacagtcacccctcttctgtaccgtgcggttagcattgcg
agcttttttcacccaaaactgcgaacatttttcactgtccgtcaaggcacgcttgatgct
cttgaaaaaaaaataaacgcactgccaaagccggttttcagaatctggatccatgcggca
tcagtcggagagttcgaacaggcgcgtccgattgtgtcggcaatgaagaaagcgcaaccg
gatattgatgtcgttgtctctttcctctcaacatcgggttatcaaaccagaaaaaattac
ccggatgcttcggcagtattttatctcccgattgacaccaaatcaaacgctcgccgtctt
atcgagatcctcaaacctgacgcactgctcgtcatgcgatatgacttctggccaaaccat
ctgatagccgcgaaaaaacacggaaccgccctgattcttgccgctgcggtactccaaaaa
aactcaccttacttcaaacctctcgttaaaacattttatcactcggttttcgcacttttc
gataagatatatacaagctcctcacgcgacaccgaatcattcagggaggttttccgatgc
aagaacacagaaacagccggagacccccgttttgaccaggtgcttctgcgaagccgcaat
acccaaagagttgcccatctttcgcctcttttcgcacatcataccgtactcgttgcagga
agcgtctggaagcaggatgaactggtcctcctgcctgcctggcaagagctgaaacatcgc
ccgtctcttatcatggtaccccatgagacagatcatgataacctggaacgactatcccgg
caccttacccaatgcaacatctccttttcaaaagtttccgaaggtattgagcattttgat
gcgataaaccaggtacttatcattgacgaaacaggataccttgcagaactatactcaatt
gcttcgatagcctatgtcgggggggggtttggaattaatgtccacaacaccatagagccg
gcagcatacggcattccggtgcttttcgggtcccgacaccacaactcgccggaagcggaa
aatctcgttgagtgcggaggagctgccgtcgtacacaacagtgcagaactcagggaaaaa
cttgcgtttctcaccgcaaacaaggagaacagaatgcgcatgggtgaacttgcgggtacc
tttgtaacaagccgtatcggagctacgaaaaaaattgccgactatatcctggaacagaag
cgcacacgtaacgacagataa

DBGET integrated database retrieval system