KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1797Help
Entry
Cpha266_1797      CDS       T00439                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cph00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2050136..2050891
Genome map
AA seq 251 aa AA seqDB search
MKTVLVTRPKDQAEPFVRELEKYGLISVVFPTIEILPVPGWSVPDLKKFDGAFFTSPNSV
RFFLERLLQEAPLELESLRDMHVWAVGKTTSKDLGVHGIVTEPLPKIADAVNLMAEIDDA
EIKGKSFLFLKGNLSLGIIPELIAAKGGLCTEITVYDNRLPSLEDTAKIKTILQEGGLSC
LSFTSPSTAENFFQAIEKKSIPEGTLIAAIGTTTAAALEKLGVTVDVIPEYFDGPTFAKA
IADALKKEPET
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttcttgtcacccgaccgaaagatcaggcagagccgtttgtcagggaactg
gaaaaatacgggctgatctcagtggtgtttcccaccattgagatcctgcctgttcccggc
tggtcagtacctgatctgaaaaaatttgacggcgcctttttcacaagtccgaacagcgtt
cgattctttcttgagcgactcctccaggaagccccgctcgagcttgagtcactcagggat
atgcatgtatgggcggtaggaaaaacaacatcgaaagacctcggagtccacggcattgta
acggagccacttcctaaaattgccgatgcagtcaatcttatggcagaaatcgatgacgcc
gagattaaaggaaaatcatttctttttctgaaaggaaatctctcacttgggataatccct
gaacttattgcggcaaagggaggactctgcaccgaaatcaccgtatacgacaatcggctg
ccttcccttgaagatacggcaaaaatcaaaacaatcctgcaggaaggagggctctcgtgc
ctatcattcaccagtccctcaacagcagaaaatttttttcaggctatcgaaaaaaaatca
attccggaaggcactctcattgctgctataggaaccacaaccgctgctgcgcttgagaag
cttggcgtaacggttgacgttataccggaatactttgacggaccaacctttgcaaaagcg
attgccgacgcactcaaaaaagaacctgaaacctga

DBGET integrated database retrieval system