KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1804Help
Entry
Cpha266_1804      CDS       T00439                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpha266_1804
Enzymes [BR:cph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cpha266_1804
Exosome [BR:cph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cpha266_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2058016..2059002
Genome map
AA seq 328 aa AA seqDB search
MSQLDLLNIVHRPRRLRKTAAIRNLVQEHTLSVNDLVFPLFVCPGTSVVEEVSSMPGSFR
YSIDNAVKECQELWDLGIQSIDLFGIPEQKTEDGSEAYNDKGIIQEAIRAIKAKLPDLCI
MTDVALDPFTPFGHDGLVKDGIILNDETVEVLCKMAVSHANAGADFVSPSDMMDGRIGAI
RESLDDAGSSDVGILSYAAKYASSFYGPFRDALHSAPQFGDKSTYQMNPGNSDEAMKEIE
LDIMEGADIVMVKPGLAYLDIVSRTKERFDVPVAIYHVSGEYSMVKAAAARGWIDEERVM
MESLLCMKRAGGDLIFTYYAKEAAKKLR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctcgacttactcaatattgtccatcgtcccagaagactccgcaaaacagcc
gcaatcagaaaccttgtacaggaacacaccctgtcagtcaacgaccttgttttcccgctc
tttgtctgccctggaaccagcgttgtcgaagaggtttcctccatgcccggcagtttccgc
tattccattgacaacgcggtaaaagagtgccaggaactatgggatctcggtatacagagc
atcgatcttttcggtattcccgagcagaaaaccgaggatggaagcgaagcctacaacgac
aagggaattatccaggaagcaatccgcgccataaaagccaagctccccgatctctgcatc
atgactgacgtcgcgctcgacccctttacccccttcggccatgacggtctggtaaaagac
ggaataatcctgaacgatgaaaccgtcgaggtactctgcaaaatggcggtttctcatgcc
aatgccggcgccgatttcgtatcgccgagcgacatgatggatggtcgtatcggagcaatc
cgcgaatcacttgatgatgcaggctcctccgatgtaggcatcctctcctatgccgccaaa
tatgcttcaagcttttacggccctttccgcgacgcactccattccgcaccacagttcggc
gacaaatcaacctatcagatgaatcccggaaactccgacgaagcgatgaaagagatcgag
ctcgacatcatggaaggcgcagatatcgtcatggttaaacccggtcttgcctatctcgat
atcgtatcacgcaccaaagaacgtttcgacgttcctgttgccatttaccacgtatcgggc
gaatattccatggtcaaagcggcagcagcacgaggatggattgatgaagagcgggttatg
atggaatccctgctctgtatgaaacgtgccggcggtgatcttatctttacctattatgcc
aaggaagctgcaaaaaaacttcgctga

DBGET integrated database retrieval system