KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1852Help
Entry
Cpha266_1852      CDS       T00439                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpha266_1852 (tpiA)
   01230 Biosynthesis of amino acids
    Cpha266_1852 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpha266_1852 (tpiA)
   00051 Fructose and mannose metabolism
    Cpha266_1852 (tpiA)
   00562 Inositol phosphate metabolism
    Cpha266_1852 (tpiA)
Enzymes [BR:cph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cpha266_1852 (tpiA)
Exosome [BR:cph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cpha266_1852 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cpha266_1852 (tpiA)
  Exosomal proteins of melanoma cells
   Cpha266_1852 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2147117..2147866)
Genome map
AA seq 249 aa AA seqDB search
MRKKIVVGNWKMNKTVTESLVLAAEVTAALGEGFTGCDVGIAPPFTALYEVGKLTGSRLA
LVAQNCHFEPDGAFTGEVSASMVREAGCSAVIAGHSERRHCFGETNAIVNRKVKHALSEG
LQVIMCAGETLEQREGGVTGDVVTAQVREGLLGIDDISNIVIAYEPVWAIGTGKTATSEQ
AEEVHLLIRNTVSDLFGEEAAGRLRIQYGGSVKPSNAKELFSMPNIDGGLIGGASLNAAD
FVAIVKAAV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaaaaattgttgttggtaactggaaaatgaataaaaccgttacagaatccctc
gtactggccgctgaagttacagccgcacttggtgaagggtttaccggttgtgacgtgggt
attgccccccctttcaccgccttgtatgaagttggcaaactgaccgggagcaggctcgca
ctcgttgcccagaactgtcattttgagccggacggggcctttaccggtgaggtatcggca
agtatggtgcgtgaggccggttgttctgcggtgatcgcagggcattccgagcgcagacac
tgttttggtgaaaccaacgcaattgtcaatcgcaaggtcaaacatgctctttccgaagga
ttgcaggtaatcatgtgtgcaggagaaacccttgagcagcgtgaaggcggagttaccggt
gacgttgtgaccgcacaggtaagggaaggtcttcttggtatcgacgatatctcgaatatc
gtgattgcctatgagccggtatgggctattggtaccggtaaaactgcgacatccgaacag
gcagaagaggtgcatcttttgattcgcaataccgtcagcgatctgtttggcgaagaagct
gccggaagactgaggattcagtatggcggcagtgtcaagccctcaaacgcaaaggagctt
ttttcgatgcccaatattgatggcggtctgattggtggagcaagtcttaatgccgctgat
tttgtcgcaatcgtgaaagccgctgtctga

DBGET integrated database retrieval system