KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1852Help
Entry
Cpha266_1852      CDS       T00439                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00010  Glycolysis / Gluconeogenesis
cph00051  Fructose and mannose metabolism
cph00562  Inositol phosphate metabolism
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
cph01120  Microbial metabolism in diverse environments
cph01130  Biosynthesis of antibiotics
cph01200  Carbon metabolism
cph01230  Biosynthesis of amino acids
Module
cph_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpha266_1852
   00051 Fructose and mannose metabolism
    Cpha266_1852
   00562 Inositol phosphate metabolism
    Cpha266_1852
Enzymes [BR:cph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cpha266_1852
Exosome [BR:cph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cpha266_1852
  Exosomal proteins of bladder cancer cells
   Cpha266_1852
  Exosomal proteins of melanoma cells
   Cpha266_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABL65868
JGI: Cpha2661852
UniProt: A1BHJ1
Position
complement(2147117..2147866)
Genome map
AA seq 249 aa AA seqDB search
MRKKIVVGNWKMNKTVTESLVLAAEVTAALGEGFTGCDVGIAPPFTALYEVGKLTGSRLA
LVAQNCHFEPDGAFTGEVSASMVREAGCSAVIAGHSERRHCFGETNAIVNRKVKHALSEG
LQVIMCAGETLEQREGGVTGDVVTAQVREGLLGIDDISNIVIAYEPVWAIGTGKTATSEQ
AEEVHLLIRNTVSDLFGEEAAGRLRIQYGGSVKPSNAKELFSMPNIDGGLIGGASLNAAD
FVAIVKAAV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaaaaattgttgttggtaactggaaaatgaataaaaccgttacagaatccctc
gtactggccgctgaagttacagccgcacttggtgaagggtttaccggttgtgacgtgggt
attgccccccctttcaccgccttgtatgaagttggcaaactgaccgggagcaggctcgca
ctcgttgcccagaactgtcattttgagccggacggggcctttaccggtgaggtatcggca
agtatggtgcgtgaggccggttgttctgcggtgatcgcagggcattccgagcgcagacac
tgttttggtgaaaccaacgcaattgtcaatcgcaaggtcaaacatgctctttccgaagga
ttgcaggtaatcatgtgtgcaggagaaacccttgagcagcgtgaaggcggagttaccggt
gacgttgtgaccgcacaggtaagggaaggtcttcttggtatcgacgatatctcgaatatc
gtgattgcctatgagccggtatgggctattggtaccggtaaaactgcgacatccgaacag
gcagaagaggtgcatcttttgattcgcaataccgtcagcgatctgtttggcgaagaagct
gccggaagactgaggattcagtatggcggcagtgtcaagccctcaaacgcaaaggagctt
ttttcgatgcccaatattgatggcggtctgattggtggagcaagtcttaatgccgctgat
tttgtcgcaatcgtgaaagccgctgtctga

DBGET integrated database retrieval system