KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1864Help
Entry
Cpha266_1864      CDS       T00439                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpha266_1864
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cpha266_1864
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cpha266_1864
Enzymes [BR:cph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cpha266_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2160053..2161141
Genome map
AA seq 362 aa AA seqDB search
MNNQELLYKKIVVKVGTNVITDKHGDLDLDILKKLTTQIALLQKEGVQIILVSSGAVGAG
RSIVKLPETLSPVATRQVLAATGQIKLINTYNTLFLEQGLVSAQILVTKSDFRDRQHYLN
MRTCFTSLLQQHIIPVVNENDAVSVTELMFTDNDELSGLIASMMHVEGYIILSHVDGLFD
LKNGTGKLITEIDPATKHFNQHIIPGKSEFGRGGMLTKCHIAHKLSQLGVTVHIANGKTP
GILLSLLRGEKAGTKFLARKKPVLGPKLWVAHSEGLEKGAVIVNEGAEKVLSDSDRANSL
LPVGIDSVQGTFKKGDIIKILGINKKVIGYGMAQYGSEKTRTLMGQQDQKPLIHYDYLYI
TH
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaataatcaggaactactgtacaaaaaaatagttgtcaaagtcggaaccaatgtcatc
acggacaaacatggcgacctcgatcttgacattcttaaaaagctcaccacccagatcgca
ctgttacaaaaggagggggtgcagattattctggtttcgtccggtgccgtcggggcaggg
cgctccattgtaaagctgccggaaaccctttcgccggttgcaacccgtcaggttcttgcc
gctaccggccagataaagctcatcaatacctacaatacgctgtttcttgaacaggggctc
gtcagtgctcagattctggtaaccaagagtgatttcagggatcgacaacactacctgaac
atgcgcacctgttttacctctctgctgcagcaacatatcattcctgttgtcaacgaaaac
gatgcggtatctgtaaccgaactgatgtttaccgacaatgacgaactctcgggcctcatt
gcttcaatgatgcatgttgagggctatatcatactgtcgcacgttgacggactttttgac
ctgaaaaacggaacgggcaagcttatcacggaaattgaccctgcaacgaaacacttcaac
caacatattattcccggaaaatcagagttcggacgaggggggatgctgacgaaatgccac
atagcccacaagctttcgcaactcggcgtcaccgttcatattgccaatgggaaaactccc
ggcattctcctctccctgcttcgcggagaaaaggccggcacgaaatttctcgcccgaaaa
aagcctgttttaggccctaaactctgggttgcacacagcgaagggcttgaaaaaggggcg
gtaatcgtcaacgaaggggccgaaaaggtactctccgactccgacagggcaaacagtctg
ctgccggtaggcatcgattcggttcagggaacgtttaaaaaaggggacattataaaaatc
ctcggcatcaacaaaaaggtgatcggctatggaatggcgcaatacggttccgaaaaaacc
cggacccttatgggtcaacaggatcagaagccgctgattcactacgattatctctatatc
acgcactga

DBGET integrated database retrieval system