KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1933Help
Entry
Cpha266_1933      CDS       T00439                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpha266_1933 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_1933 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpha266_1933 (trpA)
Enzymes [BR:cph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpha266_1933 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2240876..2241679)
Genome map
AA seq 267 aa AA seqDB search
MPENRIARLLKKNKKLLIAYYMPEFPVPGATLPVLEALQKNGADLIELGIAYSDPIGDGP
VIQDAAHTAIRNGMSVKKLLDLVRQARKGEGCRKITAPILLMGYCNPLIAYGGDCFLQDA
ASAGVDGLLLPDLPPEEADDFLERAKGFGLTVVFLVSPVTPPERIEYIDSLSTDFSYCLA
VNATTGTAKLSDAGSEAAIDEYLRRVRRHTRKKFVVGFGIKDKARVGHMWELADGAVVGT
ALLQHIAGAGTPEETARLAGEFWQTLQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaaacagaatcgcccgtcttctgaagaagaataaaaaactgctgatagcctac
tatatgcctgaatttcctgtgcctggagcgacgcttccggtgcttgaagccctgcagaag
aacggtgctgatctgatcgagcttggcatagcctattcagacccgatcggcgacggtccg
gtgattcaggatgccgctcatacggcaatccgtaacggcatgagcgttaaaaaactgctt
gatctggtcaggcaggcccgcaaaggagaggggtgccgaaagataaccgctccgatactg
ttgatggggtactgtaatccgttgatagcttacggaggagactgttttctgcaggatgcg
gcaagcgccggtgtggacggtcttctgcttcctgatcttcctcctgaagaggctgatgat
tttcttgagcgtgcaaaagggtttggccttaccgtggtctttcttgtttcacccgttact
ccgcccgaaagaattgaatatatcgactctctctcgacggatttttcatactgtcttgcc
gtaaatgccacaaccggaactgccaagctttcggatgcaggcagtgaagcggctattgac
gaatacctcaggagggtaaggcggcatacccgtaaaaaatttgttgtcggtttcggtatc
aaggataaagcaagggtgggtcatatgtgggaacttgccgatggcgctgttgtgggcaca
gctcttttgcagcatatcgccggagccggaacgcctgaagagaccgccagacttgccgga
gagttctggcagacactacagtaa

DBGET integrated database retrieval system