KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_1943Help
Entry
Cpha266_1943      CDS       T00439                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpha266_1943
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_1943
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpha266_1943
Enzymes [BR:cph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpha266_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2253049..2254248
Genome map
AA seq 399 aa AA seqDB search
MVPFHYSVPDSKGHFGKFGGKFIPETLIKNAADLELEYSRAKNDPVFQTRLATLLRDYVG
RPTPLYLAERLSGMLQGARIYLKREDLCHTGAHKINNALGQVLLAERMGKKRVIAETGAG
QHGVATATVCALFGISCVVYMGEEDIRRQSPNVARMKLLGAEVRPVGSGSKTLKDATSEA
IRDWMNNPEDTFYIIGSVVGMHPYPMIVRDFQSVIGRETRTQVLEQAGKLPDVITACVGG
GSNAIGIFHEFLPDVPGVELVGVEAAGEGLQGRHAASLTMGKTGVLHGAMTKLLQDEDGQ
ILEAHSISAGLDYPGVGPEHCYLQRKGLVSYTSTTDKEALEALKTLAATEGIICALESAH
AVHYAIKRAPEMPKDAILVVNLSGRGDKDMETIMQSIPL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgtttcactattcagttcctgattcaaaagggcatttcggtaaattcggcggg
aaatttatcccggaaacccttataaaaaacgcagccgatcttgagctcgaatacagccgg
gcaaagaatgacccggtttttcagacaaggcttgcaacgctgctgcgtgactatgtcgga
agacctaccccgctctaccttgccgaaagattgagcggaatgctccagggagcgcgcatc
tacctgaaacgtgaagacctctgtcacacaggcgcacacaaaatcaataatgcgctcggg
caggtgctgctcgctgaaagaatgggcaaaaaacgggttatcgccgaaaccggagccggc
cagcacggcgtagccaccgctacggtctgcgccctgttcggcatctcatgcgttgtctac
atgggcgaagaagatatccgccgccagtcgccgaatgttgctcgaatgaaactgctcggc
gctgaagtcagacctgtcggttcaggctcgaaaacactgaaagacgcaacaagcgaagcg
atacgggactggatgaacaaccctgaagataccttttacattatcggctccgttgtgggt
atgcacccttatcccatgatagtaagggattttcagtcggtcatcggccgcgaaaccaga
acgcaggttctcgaacaggcaggaaagctccccgatgtcatcacagcctgcgtcggtgga
ggaagcaatgccataggaatctttcatgaatttcttccggacgttcccggcgttgaactg
gttggcgttgaagcagccggagaaggacttcagggacgtcatgccgcatcactcaccatg
ggtaaaaccggcgtactgcacggcgccatgacaaaactgctgcaggatgaagacggccag
atccttgaagcgcactccatttcagccggactcgattatccgggagtaggacctgaacac
tgctatctgcaacgaaaaggtctggtcagctatacatcgactacagacaaagaagcactt
gaggcgcttaaaacactcgcagcaaccgagggaatcatctgcgcgcttgaatcagcccat
gccgtacactatgccataaaaagagcgccagagatgccgaaagatgccattcttgttgta
aacctctccggaaggggcgacaaggatatggaaacaataatgcagagtatccctctctga

DBGET integrated database retrieval system