KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2295Help
Entry
Cpha266_2295      CDS       T00439                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cpha266_2295
Enzymes [BR:cph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cpha266_2295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2626775..2627332
Genome map
AA seq 185 aa AA seqDB search
MHPQTVFLGIGSNIGNRLLHLEEAVRRLADIPDIDVIAVSRIYMTEPVGITEQDRFYNGV
VKLATSILPEDLRKQCKTIEQEIGRPENYLRWSPRVIDLDILLYGDLCCNTETLTIPHPE
LHRRKFVMVPLLDIDDPQHPVLRCPISGLLKSCEDRSVLIRTINTIPTPLPRHPHGLRDP
SLRSG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctcaaaccgtttttttaggaataggctccaacataggaaatcgcctgctgcat
cttgaagaagctgtaaggcggcttgcagacattcccgatattgatgttattgctgtctca
agaatctacatgaccgagcccgtaggaataacggagcaggatcgcttctataatggagtc
gtcaagcttgcaacatcgatcctgccggaagatctccggaaacaatgcaaaaccatagag
caggagatcggaagacccgagaactacctgcgctggagcccgagagtgattgatctcgac
attctcctctatggggacctctgttgcaacaccgaaaccctgaccataccccatccagaa
ctgcaccgccgtaaattcgtaatggtgcccctgctcgatattgacgatcctcaacatccg
gtcttgcgatgcccgatttcagggctgctcaaatcctgtgaagaccgctcggtccttatt
cgcaccataaacacaatccccacaccgctgccgcgccacccccatggactcagagatccc
tctctgcgttcgggataa

DBGET integrated database retrieval system