KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2313Help
Entry
Cpha266_2313      CDS       T00439                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cpha266_2313
Enzymes [BR:cph01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cpha266_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2652104..2655946
Genome map
AA seq 1280 aa AA seqDB search
MRFVFLTMESTNNGTLRSAAETLNQRFGLNLDVAIFNLGLHHAAPNLWEQLEERFRTADF
IFGSMLFSEEIVRPLEKLLEQALCPVCIITSNPALITQTRVGKFSLRKSKEETKEPGLFK
QWASKLKPKHSHGESQRQLALARNVSRMMKHLPGKARDIHTFIAAHQFWLNGSEENMERF
LSLLIDRYVPGWKGKLPQSDPVFYPEAGLCHPDAPEQFFSAGEYLQWQKKNHPSGGKGPV
AILAMRSTMLSKNMQHIDSLQKALESKGIDTCIAYSGGLDFRPALDRFFDPQKPGTLRPR
LLINATGFSLVGGPAETRAAEAVVAMNKLDVPCYNLIPLSFQHVEQWRESNLGLTPLQTA
LSVAVPELDGTIEPHVYAGTEAGTDRTVPLKEEIAAVANRAHRFLRLQEKPVSEKKIAIV
LFNFPPNLGNAGTAAYLNVFESLIRLLKEMKTAGYHVDLPASVEELKNKLLEGNRLIYGT
DGNVADHLPVDEYRKRFPAYTEIEPFWGDAPGEILNDRQKFHILGCSFGNIFLGQQPGFG
YERDPMRLLMAKDAAPNHAFAAFYTWIEQCFNADAVLHFGTHGALEFMPGKQTGLSSSCW
PKKLIGSLPNFYVYCVNNPSEGAIAKRRGYATIISYLTPPLEHAGLYKELARLRALIAGT
RQTTTHETMAEIRELASSLELDTGLQELPDETWLARLNSELYLVEERMIPLGLHIMGEAP
TPESLVDHLALLTSHSRPELDNRTLPELICKHRHLDYHLLIERIKDDRDAQREWQELLAI
TREAIKLFTRHLPDGQTTDHLPVRAMLEGTFTVRMAEADSYLHRQAGIKIGELQKLWHFL
QRILVNLAENREIHAVLHALEGKYTPPSPGNDLVRNPDTVPTGRNIHSLDPYSIPTHFAQ
QTGERSAEELLQVYRDENGSLPESIAIVLWGTDNLKSDGEGVAQALALLGARAKTDELGK
IGDVELIPLEQLGRPRIDVVMTISGIFRDLLSHQVKLLDKAVRMAAAADEPESMNFLRKH
VLQEMLEKNIPFSDASNRVFSNAPGSYGANVNHLVESSTWEEEEQLVDAFVSRKSFAVTE
TGQWKECPDALRSALQHVTLTFQNIDSYEIGISDIDHYYEYLGGISKTVEQISKTMPKVM
IGDINGFGKKQRICSLEKMVSLEARTKLLNPKWYEAMLEHGYEGVREIESHLTNTYGWSA
TASAVKEWTYRQFSETFLQDKAMLERLASMNVHATRAMTSRLLEAHSRGFWDADAETIEE
LREIYLDLETKIEGVHHETH
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgtctttctaaccatggagtcaaccaacaacggcaccttgcgaagtgccgct
gaaacgttgaatcagaggttcgggcttaaccttgatgttgccatttttaatcttggcctt
catcatgccgctccaaacctgtgggagcagcttgaagagcgttttcgtaccgcggatttc
atcttcggttcaatgcttttcagcgaagagatcgttcgtccgctcgaaaaactgcttgaa
caggcactctgcccggtctgcattattaccagcaaccctgcgctgatcacccagacaaga
gttggaaagttttcactccgcaaatcgaaagaggaaacaaaagaacccggcctgttcaaa
caatgggcatcaaaactcaagcctaaacacagtcatggcgaaagccagcgacagcttgcc
cttgcgcgtaacgtcagccggatgatgaaacacctccccggcaaagcaagagatattcat
acatttatagccgctcaccagttctggctgaacgggtcggaagaaaatatggagcggttc
ctctctcttctcatcgaccgctacgtacccggctggaaaggcaaactcccccagagcgat
cccgtcttttaccctgaagcgggactttgccatcccgatgcgcctgaacagttcttctcg
gcaggagaatatctccaatggcaaaaaaagaatcatccttcaggaggcaaaggccctgtt
gccattcttgccatgcgctcaaccatgctgagcaaaaacatgcagcatatcgactctttg
caaaaagcactcgaatcgaaaggcatcgacacctgcattgcatatagcggcggccttgac
ttccgtccagctctcgacagatttttcgacccccaaaaacccggcacactccgaccccgc
ctgctcattaatgccacaggattttcccttgtaggcggcccggctgaaacgagggccgca
gaggctgtcgtggccatgaataaacttgatgtcccctgctacaacctgattcccctatcc
tttcaacatgtggaacagtggagggaaagcaaccttggcctgaccccgttacagacagca
ttaagcgtagccgttccggaacttgacggcaccatcgaaccccacgtctatgccggaact
gaagcaggtaccgaccgtacggtaccacttaaagaggagatagccgctgtggcaaatcgg
gcgcatcgatttctccggcttcaggaaaaacctgtcagcgagaaaaaaatcgccattgtg
ctcttcaattttcctccaaatctcggaaatgcaggaacagccgcctatctcaacgttttc
gaaagcctcatccgtctcttaaaagagatgaaaacagccggataccatgtcgatctcccg
gcttcggttgaagagctgaaaaacaaactgctcgaaggaaatcgactgatctacggaacc
gacggcaacgtagccgaccacctgccggttgacgagtacagaaaacgttttccggcttat
acggagattgaaccgttctggggcgatgctcccggagagatactcaacgatcgtcagaag
tttcatattctcggctgctcttttggtaacatctttctgggccagcagccaggtttcgga
tatgaacgcgatccgatgcgcctgcttatggcaaaggatgccgctccaaaccatgccttt
gccgcattctacacctggatcgaacaatgtttcaacgccgatgcggtactccacttcggc
acacacggcgctcttgagttcatgcctggaaaacagaccggcctttcgagttcatgctgg
cctaaaaaactgatcggatcgctcccgaacttttatgtctactgcgtgaacaatccaagc
gaaggcgctattgcaaaacgaagaggttatgcgaccattatcagctatctcacgccacct
cttgaacatgcagggctgtacaaagaacttgcacgactccgggctcttattgccggaacc
cgtcagacgacgacccatgaaaccatggctgaaatcagagaacttgcctcatcccttgaa
ctggataccggcttgcaggagctccctgatgaaacctggcttgccagactgaatagcgaa
ctttacctcgttgaagagcgcatgattcctctcggactgcacattatgggagaagcgccg
actcctgaaagtcttgtcgatcatcttgccctgctcaccagccactctcgtccggagctc
gacaaccgcacactgcctgaactgatctgcaaacaccggcatcttgattaccatcttctc
atagagcgtatcaaagacgaccgtgatgcgcaacgggagtggcaggagttgcttgccata
acacgcgaagcgataaaactcttcaccaggcatcttcccgacggacaaaccaccgatcat
ctgccggtcagagccatgcttgagggaacctttaccgtaagaatggccgaagccgacagc
tacctgcaccgtcaggcaggcataaaaatcggtgaactccagaagctctggcattttctg
cagcggatactggttaaccttgctgaaaaccgtgaaattcatgctgtactccatgcgctt
gaagggaaatatacacccccgtctccaggcaatgatcttgttcgaaacccggataccgtc
ccgacaggaagaaacatccacagtctcgacccctacagcatcccgacgcattttgcgcag
cagaccggagagcgctccgcagaagagctgcttcaggtttacagggatgaaaacggaagc
ctgccggaatccatagcgatagtgctctggggcaccgacaatctgaaaagcgacggagaa
ggtgttgcgcaagcccttgcactgcttggagcaagagcaaaaactgatgaactgggaaaa
ataggcgatgtcgaactgattccccttgaacagctcggacgacctcgtatcgatgttgtt
atgaccatcagcggcatattcagagatctgctctcgcaccaggtcaagctgcttgacaaa
gctgtcagaatggcagcagcggccgatgaacctgaatcgatgaattttttaagaaaacat
gtgctccaggagatgctcgaaaaaaacattccgttttccgatgcctccaacagggttttt
tcaaatgcgcccggaagttacggcgcaaatgtcaatcatctggtcgaaagcagcacatgg
gaagaagaggagcagctcgtcgatgcgtttgtcagccgaaaaagttttgcggtaactgaa
accggccaatggaaagagtgccctgacgcccttcgatccgccttgcagcatgtcaccctc
accttccagaatattgacagttatgaaatcggtatttcggatatagaccattattatgag
tatcttggcggtatatcaaaaaccgttgaacagataagcaaaaccatgccgaaagtcatg
attggcgacatcaacggattcggaaaaaaacagcggatctgttctctggaaaaaatggta
tcgcttgaagcgcgaaccaagctgctcaacccgaaatggtatgaagccatgcttgagcac
ggctatgaaggagtcagagagatagagtctcacctgacgaacacctatggatggagtgct
acagcctctgccgtcaaagagtggacataccggcagttcagcgaaacattcctgcaggac
aaagccatgcttgagcgattggcatcgatgaatgtccatgcaaccagagctatgacaagc
cgtctgctcgaagctcactcaagagggttctgggatgcagatgccgagacgatcgaagag
ctccgtgaaatctatcttgaccttgaaacaaaaatagaaggcgttcaccacgaaacacac
tga

DBGET integrated database retrieval system