KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2372Help
Entry
Cpha266_2372      CDS       T00439                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
cph00010  Glycolysis / Gluconeogenesis
cph00052  Galactose metabolism
cph00500  Starch and sucrose metabolism
cph00520  Amino sugar and nucleotide sugar metabolism
cph00521  Streptomycin biosynthesis
cph01100  Metabolic pathways
cph01110  Biosynthesis of secondary metabolites
cph01120  Microbial metabolism in diverse environments
cph01130  Biosynthesis of antibiotics
cph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpha266_2372
   00052 Galactose metabolism
    Cpha266_2372
   00500 Starch and sucrose metabolism
    Cpha266_2372
   00520 Amino sugar and nucleotide sugar metabolism
    Cpha266_2372
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cpha266_2372
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cpha266_2372
Enzymes [BR:cph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cpha266_2372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABL66360
JGI: Cpha2662372
UniProt: A1BIY3
Position
complement(2756441..2757439)
Genome map
AA seq 332 aa AA seqDB search
MQRDMFRWAIGIDLGGTAIKGAVIGEQEGIVTERTIPTDTASGPEGIVEQLAGLIAALKV
QGARFFDASGFAGTGLGAPGAVNVSLGTLSYPPNLPGWTVFPLCDALQNCLKEKENLSVS
VILENDANAAAFGEAMYGAGKHFSDFLMVTLGTGVGGGIILNRQLYRGANGTAGEVGFMI
VDYEGAHVHAGIRGTLESLIGKERIVELASGMIKENPSAGHAVAELCGHDFTRLSPRHLE
HAAKQGDPLSLALWQRVGEALGVGLANVTALMDIRKFVIGGGISAAGDLIITPAFERLRR
STLPSMHEGLDIVPAELGNRAGMYGAAALCFV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagatatgtttcgatgggctataggtattgatcttggtggtacggcaatcaag
ggcgcagtcattggtgagcaggagggtattgtcaccgaaaggacaataccgaccgacacg
gcatccggacccgaaggtattgtggaacagcttgccggattaattgcagccctgaaagtg
cagggcgctcgtttttttgacgcttcgggttttgccggtacaggccttggcgcgccagga
gcggttaacgtttccctcgggacattgagctaccctcccaatcttcccggatggaccgtt
tttcctttgtgtgacgcgttgcagaactgcctgaaagagaaggagaatctatcagtatcg
gtgattcttgaaaacgatgccaacgcagcagcatttggtgaagcgatgtatggcgctggc
aagcacttcagcgattttctcatggttacgcttggaaccggagtcggtggcggaattatt
ctgaatcgacaactctacaggggggcaaacggaaccgccggcgaggtgggattcatgatc
gttgattatgaaggagcccatgttcatgcggggattcggggaactcttgaaagtcttatc
ggcaaagagcgcatcgttgaacttgccagcgggatgataaaggaaaacccgtcggcaggc
catgccgttgctgaactttgcggccatgattttacccggctctctccacgacatcttgaa
catgcagccaagcagggcgatccgctctctcttgctctctggcagagagttggagaggct
cttggtgttggtttggccaatgttaccgcacttatggatatccggaaatttgtgataggg
ggcggaatatctgctgccggagacctgattatcacccctgcattcgagcggcttcgtcgt
tcaacgctcccctccatgcacgaaggtctcgatattgttcctgcagagctcggaaacagg
gcagggatgtacggcgctgcagcgttatgctttgtgtaa

DBGET integrated database retrieval system