KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2372Help
Entry
Cpha266_2372      CDS       T00439                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpha266_2372
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cpha266_2372
   00052 Galactose metabolism
    Cpha266_2372
   00500 Starch and sucrose metabolism
    Cpha266_2372
   00520 Amino sugar and nucleotide sugar metabolism
    Cpha266_2372
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cpha266_2372
   00524 Butirosin and neomycin biosynthesis
    Cpha266_2372
Enzymes [BR:cph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cpha266_2372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2756441..2757439)
Genome map
AA seq 332 aa AA seqDB search
MQRDMFRWAIGIDLGGTAIKGAVIGEQEGIVTERTIPTDTASGPEGIVEQLAGLIAALKV
QGARFFDASGFAGTGLGAPGAVNVSLGTLSYPPNLPGWTVFPLCDALQNCLKEKENLSVS
VILENDANAAAFGEAMYGAGKHFSDFLMVTLGTGVGGGIILNRQLYRGANGTAGEVGFMI
VDYEGAHVHAGIRGTLESLIGKERIVELASGMIKENPSAGHAVAELCGHDFTRLSPRHLE
HAAKQGDPLSLALWQRVGEALGVGLANVTALMDIRKFVIGGGISAAGDLIITPAFERLRR
STLPSMHEGLDIVPAELGNRAGMYGAAALCFV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcagagagatatgtttcgatgggctataggtattgatcttggtggtacggcaatcaag
ggcgcagtcattggtgagcaggagggtattgtcaccgaaaggacaataccgaccgacacg
gcatccggacccgaaggtattgtggaacagcttgccggattaattgcagccctgaaagtg
cagggcgctcgtttttttgacgcttcgggttttgccggtacaggccttggcgcgccagga
gcggttaacgtttccctcgggacattgagctaccctcccaatcttcccggatggaccgtt
tttcctttgtgtgacgcgttgcagaactgcctgaaagagaaggagaatctatcagtatcg
gtgattcttgaaaacgatgccaacgcagcagcatttggtgaagcgatgtatggcgctggc
aagcacttcagcgattttctcatggttacgcttggaaccggagtcggtggcggaattatt
ctgaatcgacaactctacaggggggcaaacggaaccgccggcgaggtgggattcatgatc
gttgattatgaaggagcccatgttcatgcggggattcggggaactcttgaaagtcttatc
ggcaaagagcgcatcgttgaacttgccagcgggatgataaaggaaaacccgtcggcaggc
catgccgttgctgaactttgcggccatgattttacccggctctctccacgacatcttgaa
catgcagccaagcagggcgatccgctctctcttgctctctggcagagagttggagaggct
cttggtgttggtttggccaatgttaccgcacttatggatatccggaaatttgtgataggg
ggcggaatatctgctgccggagacctgattatcacccctgcattcgagcggcttcgtcgt
tcaacgctcccctccatgcacgaaggtctcgatattgttcctgcagagctcggaaacagg
gcagggatgtacggcgctgcagcgttatgctttgtgtaa

DBGET integrated database retrieval system