KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2499Help
Entry
Cpha266_2499      CDS       T00439                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cpha266_2499
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Cpha266_2499
Enzymes [BR:cph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cpha266_2499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2865580..2867349
Genome map
AA seq 589 aa AA seqDB search
MNKTPIRTIAIAILFLIAAGSISADAFGKSKSKSKPSFSKWQAQSIFSFSDSKTEKTLKQ
MTLSEKIGQMIIAQTEARSGITTDRATQQLGRLVQEGKVGGIMFMKGDAFSAALLSNYFQ
SLTARPLLMSADMERGLAMRLSGATEFPPNMALAATKETKFAFEMAKAIAKEARIVGIHQ
NYAPTVDLNINPANPIINTRSFSDNPALAIAMSNAVIEGLQSNGIAATAKHFPGHGDVTV
DSHLSLPVLNADRARLDAYELQPFKAAIDQGIISIMTGHLAVPKLTGTMEPASISKTIVT
DLLRKDLGFTGLIITDAMNMKALYNGNNVAEISVKAVQAGNDLLLFSPDPELAHNAILNA
VENGVIPRENIDASVRRILQLKHWLEIEHRKLVDLNSVMDNISPSAHRDLAEKITRNSIT
IAQNANNVIPLKIGSSSGNILSIILQDKSNSETGKHYIDEINRYYPASHLRIDPKSDDQT
FAAALELASKAPAVVISSYVQVFSGSGTLKLTLKQQEFIHKLAQSLPAGKPLIFISFGTP
YLINAFPEIHAHLCAYAANETSETYAVKALRGELSPTGTLPVSLQRNSR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacaccgatacgcacgattgccatcgccatcctcttcctcatagccgcagga
tcgatttctgccgacgcctttggaaaatcaaagtcgaaatcaaagccatcattcagcaaa
tggcaggcccagtctattttttccttcagcgactcgaaaacagaaaaaacgctgaaacaa
atgaccctttcggaaaaaatcggtcagatgattattgcccagaccgaagcgcgatccgga
attaccactgacagagcaactcaacagctcggcagactggtacaggaaggcaaagtcggg
ggcataatgtttatgaaaggcgacgccttcagcgctgcactgctctctaactactttcag
tcactgaccgcgcgcccgctgctcatgagcgccgatatggaacgaggacttgccatgagg
ctcagtggggcaaccgaattcccccccaatatggctcttgccgccacaaaagagaccaaa
tttgcctttgaaatggcaaaagctattgcaaaagaggcccggattgtcgggatacaccag
aactatgccccaaccgttgacctgaacatcaatccggccaaccccatcatcaacacccgc
tccttcagcgacaaccctgcactggccattgccatgtcaaacgccgttatcgaaggtctc
caatcaaacggaattgccgcaacggcaaaacactttccgggtcatggcgacgtcaccgtt
gacagtcacctttcgctgccagtgctgaatgccgacagagcccgcctcgacgcctatgaa
ctccagccgttcaaagcggctatcgaccagggaatcatcagtatcatgaccggtcatctt
gccgtaccgaaactcaccggcaccatggaaccggcatcaatttcaaaaaccattgttacc
gatcttcttcgcaaagatctgggcttcacgggattgatcattaccgatgccatgaacatg
aaagcgctctacaacggaaacaacgttgccgaaatatcagtaaaagccgttcaggccggc
aacgacctgcttctgttctcccccgatcccgaactggctcacaacgcgattcttaatgcc
gtcgaaaacggagtaatcccgagagaaaatatcgacgcctctgtccgacgaattctgcaa
ctcaagcattggctggaaatagaacacagaaaactcgttgacctcaattccgttatggac
aacataagtccatctgcgcaccgcgaccttgccgaaaaaatcacccggaactccataacg
attgctcagaatgccaataacgttattcctttgaaaatcggatcttcctcaggcaacatc
ctgagcattatcctgcaagacaaatcaaacagcgaaaccggcaaacactatatcgatgaa
atcaaccgatactatcctgcctcccatctgagaatagacccgaaaagcgatgaccagacc
tttgctgccgctcttgaattagcctcgaaagcaccggcagttgttatatcctcttacgta
caggtcttctccggttccggaaccctgaagctcaccctgaaacaacaggaattcatccac
aaactcgcacaatcgcttcccgcaggcaaaccgctgatcttcatctctttcggcacgccc
tatctgatcaatgcctttcctgaaatacatgcccacctgtgcgcatacgcagcaaacgaa
acaagtgaaacctatgcagtcaaggcactacggggagagcttagcccaacgggaacgctg
ccggtatcgctgcagagaaacagccgataa

DBGET integrated database retrieval system