KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2499Help
Entry
Cpha266_2499      CDS       T00439                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cph00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cph00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2865580..2867349
Genome map
AA seq 589 aa AA seqDB search
MNKTPIRTIAIAILFLIAAGSISADAFGKSKSKSKPSFSKWQAQSIFSFSDSKTEKTLKQ
MTLSEKIGQMIIAQTEARSGITTDRATQQLGRLVQEGKVGGIMFMKGDAFSAALLSNYFQ
SLTARPLLMSADMERGLAMRLSGATEFPPNMALAATKETKFAFEMAKAIAKEARIVGIHQ
NYAPTVDLNINPANPIINTRSFSDNPALAIAMSNAVIEGLQSNGIAATAKHFPGHGDVTV
DSHLSLPVLNADRARLDAYELQPFKAAIDQGIISIMTGHLAVPKLTGTMEPASISKTIVT
DLLRKDLGFTGLIITDAMNMKALYNGNNVAEISVKAVQAGNDLLLFSPDPELAHNAILNA
VENGVIPRENIDASVRRILQLKHWLEIEHRKLVDLNSVMDNISPSAHRDLAEKITRNSIT
IAQNANNVIPLKIGSSSGNILSIILQDKSNSETGKHYIDEINRYYPASHLRIDPKSDDQT
FAAALELASKAPAVVISSYVQVFSGSGTLKLTLKQQEFIHKLAQSLPAGKPLIFISFGTP
YLINAFPEIHAHLCAYAANETSETYAVKALRGELSPTGTLPVSLQRNSR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacaccgatacgcacgattgccatcgccatcctcttcctcatagccgcagga
tcgatttctgccgacgcctttggaaaatcaaagtcgaaatcaaagccatcattcagcaaa
tggcaggcccagtctattttttccttcagcgactcgaaaacagaaaaaacgctgaaacaa
atgaccctttcggaaaaaatcggtcagatgattattgcccagaccgaagcgcgatccgga
attaccactgacagagcaactcaacagctcggcagactggtacaggaaggcaaagtcggg
ggcataatgtttatgaaaggcgacgccttcagcgctgcactgctctctaactactttcag
tcactgaccgcgcgcccgctgctcatgagcgccgatatggaacgaggacttgccatgagg
ctcagtggggcaaccgaattcccccccaatatggctcttgccgccacaaaagagaccaaa
tttgcctttgaaatggcaaaagctattgcaaaagaggcccggattgtcgggatacaccag
aactatgccccaaccgttgacctgaacatcaatccggccaaccccatcatcaacacccgc
tccttcagcgacaaccctgcactggccattgccatgtcaaacgccgttatcgaaggtctc
caatcaaacggaattgccgcaacggcaaaacactttccgggtcatggcgacgtcaccgtt
gacagtcacctttcgctgccagtgctgaatgccgacagagcccgcctcgacgcctatgaa
ctccagccgttcaaagcggctatcgaccagggaatcatcagtatcatgaccggtcatctt
gccgtaccgaaactcaccggcaccatggaaccggcatcaatttcaaaaaccattgttacc
gatcttcttcgcaaagatctgggcttcacgggattgatcattaccgatgccatgaacatg
aaagcgctctacaacggaaacaacgttgccgaaatatcagtaaaagccgttcaggccggc
aacgacctgcttctgttctcccccgatcccgaactggctcacaacgcgattcttaatgcc
gtcgaaaacggagtaatcccgagagaaaatatcgacgcctctgtccgacgaattctgcaa
ctcaagcattggctggaaatagaacacagaaaactcgttgacctcaattccgttatggac
aacataagtccatctgcgcaccgcgaccttgccgaaaaaatcacccggaactccataacg
attgctcagaatgccaataacgttattcctttgaaaatcggatcttcctcaggcaacatc
ctgagcattatcctgcaagacaaatcaaacagcgaaaccggcaaacactatatcgatgaa
atcaaccgatactatcctgcctcccatctgagaatagacccgaaaagcgatgaccagacc
tttgctgccgctcttgaattagcctcgaaagcaccggcagttgttatatcctcttacgta
caggtcttctccggttccggaaccctgaagctcaccctgaaacaacaggaattcatccac
aaactcgcacaatcgcttcccgcaggcaaaccgctgatcttcatctctttcggcacgccc
tatctgatcaatgcctttcctgaaatacatgcccacctgtgcgcatacgcagcaaacgaa
acaagtgaaacctatgcagtcaaggcactacggggagagcttagcccaacgggaacgctg
ccggtatcgctgcagagaaacagccgataa

DBGET integrated database retrieval system