KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2545Help
Entry
Cpha266_2545      CDS       T00439                                 

Definition
homoserine kinase (EC:2.7.1.39)
Orthology
K00872  
homoserine kinase [EC:2.7.1.39]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpha266_2545
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_2545
Enzymes [BR:cph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     Cpha266_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2923151..2924113
Genome map
AA seq 320 aa AA seqDB search
MKTVRGFASATVGNVACGFDVLGFAITEPGDEVILTLHEERKSECPVSITAISGDGGALP
LDPKKNTSSFVVLKFLEYIRTSKGIDFKGHIDLELKKNLPLSSGMGSSAASAAAALAAAN
ELLGQPCSKMELVHFAVEGERVACGSAHADNAAPAILGNFVLIRSYAPLDLITIPSPEHL
FCTLVHPHTELKTSFARSVLPRSIPLKTATQQWGNVGALIAGLLKSDYDLIGRALVDVVA
EPKRAPLIPGFLDVKHAAIDCGALGCSIAGSGPSVFAFSSSKETAERVGQAMREAFLLPE
TNLKSDMWVSPICKEGAKVL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtcagaggattcgcttcagcaaccgtaggaaacgtcgcctgcggtttcgat
gttttgggattcgccattaccgaaccgggcgatgaggtaatactcacgctccatgaagaa
cgaaaaagcgagtgcccggtctccatcaccgccatttccggagatggaggagcgctgcct
ctcgatccgaaaaaaaacacctcgagctttgtcgttctgaagttcctcgaatacatacga
acaagcaaaggaattgacttcaaaggacacatcgaccttgagctgaaaaaaaaccttccc
ctgagcagcggcatgggcagcagtgcggcaagtgcggcagcggcgcttgccgccgcaaac
gagctcctcggtcaaccctgctcaaaaatggaactggtacacttcgccgttgaaggagaa
cgcgttgcctgcggctcagcccatgccgacaacgcagcgccggcgattctcggcaatttc
gtgcttatccgcagctacgcgccgcttgatctcatcacgataccctcgcccgagcatctc
ttctgcacccttgtgcacccgcataccgagctgaaaacatcctttgcccgctcagtactg
ccaaggtccataccgcttaaaacagcaacccagcaatggggaaacgtcggcgcacttatc
gccggacttctgaaatcggattacgatctcataggccgcgcactcgtcgatgtagtagcc
gaacccaaacgagcgccgctgattccgggctttctcgacgtcaaacatgcagcgatcgac
tgcggagcgctcggatgcagcattgccggttcaggcccctccgtctttgccttttcctcc
tcaaaagagacggcagaacgcgtcggccaagccatgcgagaggcatttctcctccctgaa
acaaacctcaagtcagatatgtgggtatcaccgatctgcaaggaaggcgcaaaagtattg
taa

DBGET integrated database retrieval system