KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2545Help
Entry
Cpha266_2545      CDS       T00439                                 

Definition
homoserine kinase (EC:2.7.1.39)
Orthology
K00872  
homoserine kinase [EC:2.7.1.39]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpha266_2545
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_2545
Enzymes [BR:cph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     Cpha266_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2923151..2924113
Genome map
AA seq 320 aa AA seqDB search
MKTVRGFASATVGNVACGFDVLGFAITEPGDEVILTLHEERKSECPVSITAISGDGGALP
LDPKKNTSSFVVLKFLEYIRTSKGIDFKGHIDLELKKNLPLSSGMGSSAASAAAALAAAN
ELLGQPCSKMELVHFAVEGERVACGSAHADNAAPAILGNFVLIRSYAPLDLITIPSPEHL
FCTLVHPHTELKTSFARSVLPRSIPLKTATQQWGNVGALIAGLLKSDYDLIGRALVDVVA
EPKRAPLIPGFLDVKHAAIDCGALGCSIAGSGPSVFAFSSSKETAERVGQAMREAFLLPE
TNLKSDMWVSPICKEGAKVL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtcagaggattcgcttcagcaaccgtaggaaacgtcgcctgcggtttcgat
gttttgggattcgccattaccgaaccgggcgatgaggtaatactcacgctccatgaagaa
cgaaaaagcgagtgcccggtctccatcaccgccatttccggagatggaggagcgctgcct
ctcgatccgaaaaaaaacacctcgagctttgtcgttctgaagttcctcgaatacatacga
acaagcaaaggaattgacttcaaaggacacatcgaccttgagctgaaaaaaaaccttccc
ctgagcagcggcatgggcagcagtgcggcaagtgcggcagcggcgcttgccgccgcaaac
gagctcctcggtcaaccctgctcaaaaatggaactggtacacttcgccgttgaaggagaa
cgcgttgcctgcggctcagcccatgccgacaacgcagcgccggcgattctcggcaatttc
gtgcttatccgcagctacgcgccgcttgatctcatcacgataccctcgcccgagcatctc
ttctgcacccttgtgcacccgcataccgagctgaaaacatcctttgcccgctcagtactg
ccaaggtccataccgcttaaaacagcaacccagcaatggggaaacgtcggcgcacttatc
gccggacttctgaaatcggattacgatctcataggccgcgcactcgtcgatgtagtagcc
gaacccaaacgagcgccgctgattccgggctttctcgacgtcaaacatgcagcgatcgac
tgcggagcgctcggatgcagcattgccggttcaggcccctccgtctttgccttttcctcc
tcaaaagagacggcagaacgcgtcggccaagccatgcgagaggcatttctcctccctgaa
acaaacctcaagtcagatatgtgggtatcaccgatctgcaaggaaggcgcaaaagtattg
taa

DBGET integrated database retrieval system