KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2546Help
Entry
Cpha266_2546      CDS       T00439                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpha266_2546
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_2546
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cpha266_2546
Enzymes [BR:cph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cpha266_2546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2924140..2925456
Genome map
AA seq 438 aa AA seqDB search
MIYFSTNKSSTPVSIKKATLEGLAPDGGLYVPSEIPKFSAQELALLEDASFCNIALAIAK
KFIGGAIPPDQLSDMIESCYPFDTPLVELEQNTFIEELFCGPTLAFKDYGARFLARLTGW
FAAEDDRLITVLVATSGDTGSAVAYGFQGIANTRVVLLYPSGKVSRLQEQQLTTAGNNVE
ALEVKGDFDDCQRLVKQAFVDPALKERLTLTSANSINISRLIPQSFYYAWAAMQLKTGYG
LTHPVFSVPSGNYGNITAGVLAKLMGFPVGHFVAASNANDSVTRYLEDGRYEPHPTITTI
STAMDVGDPSNFARLRYLYGNDYRAMKKEITGVAISDKATRETIIKLHNEFGYIADPHTA
VGFRALEEYRKASGNRSAGVVLSTAHPAKFLEAIEETLNKKIAIPDRLQAVLERKKQATL
INASYNELAGFLEHLDKH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatctatttcagcaccaataaatcatccacccccgtttcgataaaaaaagcgaccctt
gaagggcttgctcccgacggcgggctctatgttccctctgaaataccgaaattttcagcg
caggagcttgccctgcttgaagacgcaagcttctgcaatatcgctcttgcgatagcaaaa
aaatttatcggaggagcaatccctcccgatcagctcagcgacatgattgaaagctgttac
cctttcgatacgccgcttgtcgagctcgaacaaaacacctttatcgaagaacttttctgt
ggacccaccctggcattcaaagactacggcgcacgttttcttgcccggctcaccggctgg
tttgccgcagaagacgacaggctgatcaccgtgcttgtcgcaacgtcaggagacacaggc
agcgccgtagcctacggatttcagggaattgcgaacacacgggtcgtgctcctctacccc
tcgggaaaagtaagccgactgcaggaacaacagctcaccactgcaggaaacaatgtcgaa
gcgcttgaagtaaaaggcgatttcgacgactgccagcgactggtcaaacaggcatttgtc
gatcccgctctcaaagagaggctcaccttgacctcggcaaactcgatcaacatatcaaga
ctgatcccccaatcattttactatgcctgggcggccatgcaactgaaaaccggatacggg
ttgacccatccggtattctcggtgccgagcggcaactacggaaacatcacggccggcgtg
cttgcaaagctcatgggtttccctgtcggccatttcgtagccgcatcaaatgcaaacgac
agcgtcacccgatacctcgaagacggaagatatgaaccgcacccgaccatcacaaccatc
tcaacggcaatggatgtaggcgatccgagcaacttcgcccgcctcagatatctctacgga
aacgattaccgggccatgaaaaaagagataacgggagtagccatatcggacaaggcgacc
agagaaacaattatcaagctccataacgagttcggctatattgccgatccccataccgcc
gtcggatttcgcgcccttgaagagtaccgtaaagcaagcggaaaccgttcggcaggagtg
gtactctcaacagctcatccggcaaagtttctcgaagccatagaggagacactcaataaa
aaaatcgccattcccgatcgcctgcaagccgtgctcgaaagaaaaaaacaggccaccctc
atcaacgccagctataacgaactggccgggtttctggaacatctcgacaagcattaa

DBGET integrated database retrieval system