KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2546Help
Entry
Cpha266_2546      CDS       T00439                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpha266_2546
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpha266_2546
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cpha266_2546
Enzymes [BR:cph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cpha266_2546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2924140..2925456
Genome map
AA seq 438 aa AA seqDB search
MIYFSTNKSSTPVSIKKATLEGLAPDGGLYVPSEIPKFSAQELALLEDASFCNIALAIAK
KFIGGAIPPDQLSDMIESCYPFDTPLVELEQNTFIEELFCGPTLAFKDYGARFLARLTGW
FAAEDDRLITVLVATSGDTGSAVAYGFQGIANTRVVLLYPSGKVSRLQEQQLTTAGNNVE
ALEVKGDFDDCQRLVKQAFVDPALKERLTLTSANSINISRLIPQSFYYAWAAMQLKTGYG
LTHPVFSVPSGNYGNITAGVLAKLMGFPVGHFVAASNANDSVTRYLEDGRYEPHPTITTI
STAMDVGDPSNFARLRYLYGNDYRAMKKEITGVAISDKATRETIIKLHNEFGYIADPHTA
VGFRALEEYRKASGNRSAGVVLSTAHPAKFLEAIEETLNKKIAIPDRLQAVLERKKQATL
INASYNELAGFLEHLDKH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgatctatttcagcaccaataaatcatccacccccgtttcgataaaaaaagcgaccctt
gaagggcttgctcccgacggcgggctctatgttccctctgaaataccgaaattttcagcg
caggagcttgccctgcttgaagacgcaagcttctgcaatatcgctcttgcgatagcaaaa
aaatttatcggaggagcaatccctcccgatcagctcagcgacatgattgaaagctgttac
cctttcgatacgccgcttgtcgagctcgaacaaaacacctttatcgaagaacttttctgt
ggacccaccctggcattcaaagactacggcgcacgttttcttgcccggctcaccggctgg
tttgccgcagaagacgacaggctgatcaccgtgcttgtcgcaacgtcaggagacacaggc
agcgccgtagcctacggatttcagggaattgcgaacacacgggtcgtgctcctctacccc
tcgggaaaagtaagccgactgcaggaacaacagctcaccactgcaggaaacaatgtcgaa
gcgcttgaagtaaaaggcgatttcgacgactgccagcgactggtcaaacaggcatttgtc
gatcccgctctcaaagagaggctcaccttgacctcggcaaactcgatcaacatatcaaga
ctgatcccccaatcattttactatgcctgggcggccatgcaactgaaaaccggatacggg
ttgacccatccggtattctcggtgccgagcggcaactacggaaacatcacggccggcgtg
cttgcaaagctcatgggtttccctgtcggccatttcgtagccgcatcaaatgcaaacgac
agcgtcacccgatacctcgaagacggaagatatgaaccgcacccgaccatcacaaccatc
tcaacggcaatggatgtaggcgatccgagcaacttcgcccgcctcagatatctctacgga
aacgattaccgggccatgaaaaaagagataacgggagtagccatatcggacaaggcgacc
agagaaacaattatcaagctccataacgagttcggctatattgccgatccccataccgcc
gtcggatttcgcgcccttgaagagtaccgtaaagcaagcggaaaccgttcggcaggagtg
gtactctcaacagctcatccggcaaagtttctcgaagccatagaggagacactcaataaa
aaaatcgccattcccgatcgcctgcaagccgtgctcgaaagaaaaaaacaggccaccctc
atcaacgccagctataacgaactggccgggtttctggaacatctcgacaagcattaa

DBGET integrated database retrieval system