KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2578Help
Entry
Cpha266_2578      CDS       T00439                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cph00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cph00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2953213..2954340
Genome map
AA seq 375 aa AA seqDB search
MKRNRFPLSLLIMLLMLQTPAAWAAKEPDSLGIKIGQMIMTGFRGCSLAESPQIASDIRR
QRIGGVVLFDYDVPSRSPIRNITTPSRLMKLTRELQGITEIPLLIAIDQEGGRVNRLKPA
LGFPPSLSAARLGKLDNTDSTTAEAAKTAETLKTMHLSMNLAPVVDLNSNKENPVIGKLQ
RSFSDDPDVVTRNARATCNAFREKGIIATLKHFPGHGSSTTDTHKGFTDITGTWRENELQ
PYRQLIAGGYNDAIMTAHVYNATIDSLYPATLSKKTLKGILREKLGFRGVIITDDMQMKA
IADHYGLEEALRLAIEADADILLFGNNTTFDPDIARKAIAIIRTMVSKKIITTDRIDRSY
RRIMTLKERYLFQCK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaccgattcccgctctcactgctgatcatgctcttgatgcttcagaccccg
gctgcctgggcggcaaaagagcctgacagtctgggaatcaaaatcggccagatgattatg
accggattcagaggttgctctcttgcggaatcgccgcaaattgcatcggatatccggcgg
caacgaataggcggggtcgtactcttcgactacgacgttccatcccgctcgcccatccgt
aacatcacaacgccctcccggctcatgaaactgaccagagagcttcagggaataacggaa
attccgctccttatcgccatcgaccaggagggagggcgggtaaaccgcctcaaacccgct
ctcggctttcccccgtcgctctcggccgcccggctcggaaaactcgacaataccgacagc
acaaccgcagaggcagccaaaacagcggaaacgctgaaaaccatgcacctgtcgatgaac
ctcgccccggtcgtcgatctcaacagcaacaaagagaaccctgtcatcggcaaacttcag
agaagtttttccgacgacccggacgtcgtcacaagaaacgcccgggccacctgcaacgca
ttccgcgaaaaaggaatcattgcgaccctcaaacactttcccggccacggcagctcaacc
accgatacccacaaaggatttaccgacattaccggcacctggcgcgaaaacgagctccag
ccataccgtcagctcatagccggagggtacaacgacgccatcatgaccgcacacgtctac
aacgcaacgatcgacagcctctaccccgcaacgctctcaaaaaaaacactcaaaggaatc
cttcgtgaaaaactcggcttcagaggggtaatcatcaccgacgacatgcagatgaaagcg
attgccgaccattacggactcgaagaggctctccgtcttgccatcgaagccgatgccgac
atcctgctgttcggcaacaacacaacctttgaccccgacatcgccagaaaagccattgcc
atcatcagaacgatggtcagtaaaaaaatcatcaccacggaccgaatcgaccgctcctat
cgaagaatcatgacgctcaaagaacgatacctctttcaatgcaaatga

DBGET integrated database retrieval system