KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2590Help
Entry
Cpha266_2590      CDS       T00439                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cpha266_2590
Enzymes [BR:cph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cpha266_2590
Exosome [BR:cph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cpha266_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2966456..2967907)
Genome map
AA seq 483 aa AA seqDB search
MAILAIDQGTTGTTCVLYNEKAEVLGKAYRELRQIYPCEGWVEHDPEEIWQSVVLCVREL
LERCPVTIAALGITNQRETTIVWERASGRPVYHAIVWQCRRTTELCRRFEQEKGMIAEKT
GLPLDAYFSATKIRWILDTCSHLSPDALLFGTVDSWLVWKLTGGGVHATDFTNASRTMLY
NIREKRWDGELLDLFGIPGSMLPEVRPSMDDFGRVSALDELAGVPVLAVAGDQQAALFGQ
CCFEPGSIKNTYGTGCFMVMNTGDACIRSHNGLLTTLAIDAGGRPCYALEGSVFIGGAVV
QWLRDELQLMKHASESEAMARAAGSNGGVYLVPAFVGLGAPHWQMEARGTIVGLTRGTNK
NHIVRAALESIAFESYDVFRAMVADSGISPDALAVDGGAADNGFLMQFQADLLGIPVLKA
ANIESTSLGAAFLCGLRAGIWKSDGELRMVNRHAQACYPSMEPETRDALLCGWQKALRQT
LVR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggctattcttgcgattgatcagggaacgacgggaacaacctgcgtgctctataatgaa
aaggctgaggttctcgggaaggcttaccgggagctgaggcagatttatccctgcgagggt
tgggttgagcacgatccggaagagatctggcagagcgttgtgctttgtgtccgggagctt
cttgagcgatgcccggtgacgattgccgctctgggtataacgaatcagcgggaaacaacg
attgtctgggagcgggcaagcggtcgtccggtgtatcatgcgattgtctggcagtgcaga
cgcacgacggagctttgccggcgatttgagcaggaaaaagggatgatcgcagaaaagacg
gggctgccgcttgatgcgtatttcagcgcaacgaaaatccgctggattctcgatacctgt
tctcatctttctccggatgctcttcttttcggtacggttgacagttggctggtgtggaaa
ctgaccggcggcggggttcatgcgaccgattttaccaatgcgtcgagaacgatgctttat
aatatcagggagaagcggtgggatggggagcttctcgatctgtttggaattcctggttcg
atgttgccggaggttcgtccgtcaatggatgattttggccgggtgagcgctcttgatgag
ctggcgggggtgccggtgcttgcggttgccggcgatcagcaggccgctctgttcgggcag
tgctgttttgagccgggctctatcaagaatacctatggcacgggttgttttatggttatg
aataccggcgatgcatgtatccgttcgcataacggtcttctgacgacgttggctattgat
gccggagggcgtccctgttatgctcttgagggttctgtttttatcggcggcgcggtggtt
cagtggttgcgcgacgagttgcagttgatgaagcatgcttcggagtctgaggcgatggca
agagcggcgggttcaaatggaggggtttatcttgttcctgcttttgtcggcctcggggcg
cctcattggcagatggaggcgcggggaacgattgtcgggttgacgaggggtacgaataaa
aatcatattgtgcgggccgctctggagtccattgcttttgagtcgtacgatgtgttcagg
gccatggttgcggattcgggaatctcgcctgatgcgttggctgtcgatggcggggcggcg
gataacgggtttcttatgcagtttcaggcggatctgcttggcattccggttctgaaggcg
gcgaatatcgagtcgacttcgcttggcgcggcttttctctgcgggttgcgggccggcatc
tggaagtcagatggggagttgcgcatggttaatcggcatgcgcaggcctgttatccttcc
atggagcccgagacgagggatgctctgctttgcggctggcaaaaggctctccgccagacg
ctggtgaggtag

DBGET integrated database retrieval system