KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2597Help
Entry
Cpha266_2597      CDS       T00439                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cph01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cph01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cph00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cph00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cph00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cph00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cph00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2977578..2978612)
Genome map
AA seq 344 aa AA seqDB search
MILCHMVDNKNMRDDSHRKPRLQKIGVFTSGGDAPGMNAAIRAVTRAAIANKLKVVGIRR
GYQGMIEGDFIPLRSADVSGIIQLGGTVLRTARSNEFRTFEGRQKAWLQLQKAGIDAVVV
IGGDGSFTGALTMSQEFNISFVGIPATIDNDMYGTDYTIGYETALNSVVCAVDKIRDTAV
SHGRIFIVEVMGREAGLLALNGGIACGAEVILIPESKEQHDELKRFLDKGYRHKERSGII
MVAEGDEPGGALKIAEQVRREHPDLDVRVSILGHIQRGGSPTANDRVNATRMGVAAVDAL
LDDQKSIMIGIDDGKIVQVPFNKAVKLNHSIDGDLLDIQRMLNI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatattgtgtcacatggtagataataaaaatatgagggatgattcgcacaggaagccg
aggttacagaaaatcggcgtttttacttctggcggcgatgctccagggatgaatgctgct
atccgggctgtgactcgggcggcaattgctaataaattgaaggttgtgggtattcgtcgc
gggtatcaggggatgatcgagggagattttattccgctgaggtcggctgatgtcagcggc
attatccagttgggggggactgttttgagaacggctcgcagtaatgaattcagaactttc
gaaggtcgccagaaagcctggttgcagttgcagaaggctggtattgatgcggtggtggtg
attgggggtgatggttcttttactggcgcgttgacgatgtcgcaggagttcaatatttcg
tttgtgggtattcctgctactattgataatgatatgtatggtacggattatactatcggt
tatgaaacggcgttgaattctgttgtgtgtgccgtcgataaaatcagggatacggctgtt
tcgcatgggagaatttttattgttgaggttatgggtcgtgaggctggtttgctggctttg
aacgggggtattgcctgcggggctgaggttattttgattcctgagtcgaaggagcagcat
gatgagttgaagcggtttcttgataagggttaccggcataaggagcggagcgggattatt
atggttgctgagggtgatgagcctggaggtgctttgaaaattgctgagcaggtgcgcagg
gagcatcctgatcttgatgtgcgtgtttctattttgggtcatattcagcgtggtggtagt
ccgacggctaatgacagggttaatgcgacgcggatgggtgttgctgctgttgatgctttg
cttgatgatcagaagagtattatgatcgggattgatgatggtaaaattgtgcaggttccg
tttaataaggctgtgaagttgaatcatagtattgatggtgatttgctggatattcagagg
atgttgaatatttaa

DBGET integrated database retrieval system