KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2693Help
Entry
Cpha266_2693      CDS       T00439                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cpha266_2693
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Cpha266_2693
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cpha266_2693
Enzymes [BR:cph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Cpha266_2693
Exosome [BR:cph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cpha266_2693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3086482..3087987)
Genome map
AA seq 501 aa AA seqDB search
MRHFLTNRTKRIALFSSALFVLILLSAPLDAASRRTTKPAGAPRYIFLFIGDGMGLAQAA
LSDAMRERGTPGLVMNTFPSIGIATTHAENRFITDSGAAGTALATGSKTSIGTISMAANH
NDTLRTIAEMVKAKGMKVGIVSTVGINDATPACFYAHNANRKNVYNIALQMPSSGVDYFG
GGYANGNLPQNRKSGTSFRGDIVDLMKSRNYAVVTEREQLGSVQPGTRCWAYTAYDEQGA
MSYALDRKQKEISLAEFTREGIRLLDNPRGFFMMVEGGKIDWACHANDAAAVAGDVRDFD
RAIAEAVLFYRKRPHQTLIIVTADHECGGLTLGNAARGYASRFELLGYQKISGERFAEKV
ATWKKNRNISFPMALDSIKVYYGLGNAAADSALALSSADRQSLNDAYSSSMAREVSDKNR
YSAPDALATVATGMLNRRAGIGWTSPVHTALPVQVMALGVGASVFTGFYDNTDIAAKIIA
ASQLKPFIEKQKRSKNIANRP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgcgacattttctgacgaacagaacaaaaagaatcgcgctgttttcatcagcgctgttc
gttctcatattgctgtcggctccgctcgatgccgcatcgcggaggacaacgaaacccgca
ggcgctcctcgctatatctttctctttatcggcgacgggatggggctcgcacaggcggca
ctctccgatgcgatgcgagaaaggggcacccctgggctggtgatgaacacattcccttca
atcggcatcgcaaccacccatgccgaaaaccgtttcattaccgattccggagcggccgga
acagcgcttgctaccggaagcaagacgagcatcgggactatttccatggccgcaaatcat
aacgatacgctcagaaccattgccgaaatggtgaaagcgaaaggcatgaaagtcggcatt
gtcagcactgtcggcattaacgatgcaacgcccgcctgtttctatgctcataacgccaac
cggaaaaatgtatacaacatcgccttgcagatgccctcaagcggggttgactatttcggc
ggaggctacgccaacggaaaccttccgcaaaaccgcaaaagcggaacctcctttcgcggc
gatattgtcgatctcatgaaatcccgtaactatgctgttgtaaccgaaagagagcagctc
ggaagcgttcagcccggaaccagatgctgggcctatacggcatatgatgaacaaggagcc
atgagctatgctctggatcgcaagcagaaagagatctcccttgccgaatttacccgcgaa
ggtattcgtctgctcgacaacccgagaggctttttcatgatggttgaagggggaaaaatc
gactgggcctgtcatgccaatgatgctgctgctgtcgctggcgacgtgcgtgactttgat
cgggcaatagccgaagccgttctgttttatcgaaagcgcccgcatcaaaccctcattatc
gtaaccgccgaccacgaatgcggagggttgacgcttggcaatgcggcacgcggttatgca
tcgcggtttgagttgctgggttaccagaaaatctccggagagcgctttgccgaaaaagtc
gcgacatggaaaaaaaaccgcaacatatcctttcccatggcgcttgacagtataaaagtc
tactatgggcttggcaatgccgcagccgactccgcccttgccctctcctctgctgatcgc
cagtcgctcaacgatgcctactcgtcgagcatggcaagagaggtatcggacaaaaatcgc
tacagcgcaccggatgcattggcgacagtcgcgacaggaatgctcaacaggagggccgga
atcgggtggacaagtccggttcatacagcccttccggtacaggttatggctcttggggtc
ggagcttccgtatttaccgggttttacgacaataccgatatagcagctaaaatcatcgcc
gcttcacaactcaagcccttcatcgaaaagcagaagagaagtaaaaatattgcaaacagg
ccctga

DBGET integrated database retrieval system