KEGG   Chlorobium phaeobacteroides DSM 266: Cpha266_2696Help
Entry
Cpha266_2696      CDS       T00439                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cph  Chlorobium phaeobacteroides DSM 266
Brite
Enzymes [BR:cph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Cpha266_2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3088886..3089656)
Genome map
AA seq 256 aa AA seqDB search
MTEKQQQKTQLGILVFHGFTATTDSVSLLVDALHRTGVLVRAPLLAGHGASSPEALRGIT
CTDWLTDAEKAFSQLSASCEKIILVGHSMGALLALNLAVRHESRVDSLVLAAPAIKLYSI
FSPGRPLYRFAPLLARVKKKWEMKTAIADRRYALGTGRYAWVPTDTILSFFLLIEKTISE
LGSVTVPLFILHNRRETTVMPESATILCNAIATGVSNKSIVWLEHSEHQMFCDSERELAV
RAIVDFVDRRVHHNRS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaagcaacaacagaaaacccaactcggtattcttgtttttcacggttttacg
gcaacgaccgacagcgtctccctgcttgtcgacgcattacatcgcaccggagtgctggta
cgagcaccgcttcttgccggacacggagcgtcatcgcccgaagcgcttcgcggaatcacc
tgcaccgattggctgaccgacgccgaaaaagccttcagtcaactctccgcttcatgcgaa
aagattattcttgtcggtcacagcatgggcgctcttcttgctcttaaccttgccgtgcga
catgaaagcagggttgattcccttgtcctcgccgccccggcaataaagctgtattccata
ttttctcccggtcgaccgctttatcgttttgcgccgcttcttgcaagagtgaaaaaaaaa
tgggagatgaaaaccgcaattgccgatcggcgttatgccctgggcacgggccgttatgcc
tgggtccccaccgataccattctctcttttttcctcctgatagaaaaaacaatatccgag
ctcggatccgtcactgtcccgctctttatcctgcacaaccgaagggaaaccaccgtgatg
cctgaaagcgcgaccatactatgcaatgcgatagcgacaggcgtctcgaacaaatcaatt
gtatggcttgagcactcggaacatcagatgttctgcgacagcgagagggaacttgccgtt
cgagcgatagtggatttcgtcgatcgtcgggtgcatcataaccgatcctga

DBGET integrated database retrieval system