KEGG   Chitinophaga pinensis: Cpin_0006Help
Entry
Cpin_0006         CDS       T00959                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cpi  Chitinophaga pinensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cpin_0006
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Cpin_0006
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Cpin_0006
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Cpin_0006
Exosome [BR:cpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cpin_0006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9027..10859
Genome map
AA seq 610 aa AA seqDB search
MLKSYLLSLSLLTTITATAQTSTYAPINAHSHNDYEHPIPFLTAYFRHYGSIEADVFERN
GQLFTAHTEEAIRPERTLEKLYLHPLREQIKNNGGTAYKNSKDTLQLMIDFKTTGVPTMK
ALVKILDRYPDITKNPTVVITISGDQPALGLWGQYPDYIHFDGKRGFTYTAAQEKRIPMY
SVDIKQFTNWNGKGVIVKEEKVKIQQWVDSVHQAGKKVRFWGMADNVNTWKTQMNMGADF
LGTDLVEDMANFLSNRQNLEYNGTAAPHTLYNARYVNNDSMGKVTNVILLIGDGMGLAQI
YAGFTGNHGQLNLLQMKNIGFSKTYSSDSYITDSAAGGTAMASGKKTNNRYVGVDATAVR
IPAIPDIIAPKGYNSALISAGDITDATPAAFYGHVPERSMEDSIAANFLNSPVSIMIGGG
AKHFNQRKDGKDLPKLLHDKGYTFSTNLAELNNIQSDKYLVLDSLAERSMLKGRGEFLTQ
SLEKSIASLRKQNKGFFIMAEGAQIDYGGHANIVPYVATEMMDFDKAIGAAMKFADEDGH
TLVIVTADHETGGLSLLDGNISKGYVDGHFSTNDHSAVMVPVFAYGPHSLDFRGVYENTE
IFAKIIALLQ
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaatcttacctgctttctctttctctactaacgactatcacagctaccgctcag
accagcacctatgcaccgatcaatgcacattcgcataatgactatgaacatccgattccg
ttcctgacggcttatttccgtcattacggatcaatagaagcagatgttttcgaacgcaac
ggtcaactgttcaccgctcataccgaagaagcgatccgtccggaacgtacactggagaag
ttgtacctgcatcctttacgggagcagatcaaaaataacggaggtaccgcctataaaaac
agtaaggatactttacagctgatgatcgatttcaagaccaccggcgtgcctaccatgaaa
gcactcgtaaagatcctggaccgctatccggatatcacaaagaatccgacagtagtcatc
accatcagtggcgaccagccggctcttggactctggggccagtatcctgactacattcac
ttcgacgggaaacgcggattcacctacaccgctgcacaggaaaaacgtatcccgatgtac
agtgtagacatcaaacaatttaccaactggaatggtaaaggcgtaatcgtaaaagaagaa
aaagtaaaaattcagcaatgggtcgatagcgtacaccaggctggcaaaaaagtgcgtttc
tggggcatggctgacaatgtgaacacctggaaaacccagatgaatatgggcgctgatttt
ctcggcaccgacctcgtggaagatatggccaacttcctgagcaacagacaaaaccttgaa
tacaacggcactgccgctcctcatacactgtacaatgcccgttatgtaaataatgacagc
atgggtaaagtgaccaacgttattctcctgatcggtgacggtatgggccttgcccagatt
tatgccggtttcaccggtaaccatggccagctgaatctcctgcaaatgaagaatatcggt
ttctctaaaacctactcttctgatagctacattaccgattcggcagcaggtggcaccgca
atggcgagtggcaaaaagacgaacaatcgctatgtaggtgtagacgctaccgctgtacgc
atccctgccattcctgatatcatcgcccccaaaggatataacagcgcgctgatcagcgcc
ggcgacattacagatgctactcctgccgcattctacggacatgtgccggaaagaagtatg
gaagactctattgccgctaatttccttaacagcccggtaagcattatgattggcggtggt
gcaaaacacttcaaccagcgcaaagatggcaaagacctgcctaaattgttacacgataaa
ggttataccttcagcaccaacctcgctgaactgaacaatatccagtctgataaatacctc
gtactggacagccttgcagaacgctccatgctgaaaggcagaggcgaattcctgacacag
tcactggaaaaatcgattgcttccctgcgtaaacaaaataaaggcttctttattatggct
gaaggcgcacagattgactatggaggtcatgcgaacattgtaccttatgtagcgactgaa
atgatggatttcgataaagcgatcggtgctgctatgaaatttgcagatgaagacggtcat
acactggtaattgtaactgccgatcacgaaacaggtggtttgtccttactggatggtaat
atctctaaaggctacgtagacggtcatttcagtaccaatgatcatagcgctgtaatggta
cctgtatttgcttatggtcctcattcactggatttcagaggggtttatgagaatacagag
atctttgcaaaaattattgcactgctgcagtaa

DBGET integrated database retrieval system