KEGG   Chitinophaga pinensis: Cpin_0350Help
Entry
Cpin_0350         CDS       T00959                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cpi  Chitinophaga pinensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(416277..417212)
Genome map
AA seq 311 aa AA seqDB search
MKKWLITGLLVTASTLLAFHSEEPLTRVTLGEKLFFDPVLSMDRTVSCASCHRPQFAFAD
TSTFSKGIHDKLTKRNTPALTNQSGRPSFFWDGRAATLEEQAKQPIISPDEMGLPIDEAV
KRLNADSTYVQAFRKIFNSAPTEKNLLQALAAFERTLETANSPYDRYINGDDNAISATAA
RGRLLFIGKANCNNCHSGEDFTADRFKNIGLYNGTTLKDAGRFDITHDSAQLGFFKVPSL
RNVAVTAPYMHNGMFRTLREVIVYYNTPDALIHDGIKRDLSLNTPLNLTDTEIDELEAFL
KTLTDDRFINQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtggctcatcacaggtttgttagtgaccgcatctaccctgctggcttttcat
tcagaagaaccgctgacgcgggtgaccctcggagaaaaattgttttttgatccggtatta
tcgatggacaggactgtcagctgtgcttcctgccataggccacagtttgcctttgccgat
acgtcaaccttcagcaaaggcattcatgacaagctcaccaagcgaaatacccctgcgctc
acgaaccaaagtggccggcccagctttttctgggatggacgggccgccacattggaggag
caggcaaagcaaccaatcatctctcctgatgaaatgggactgcccattgatgaagcggta
aagcggttgaacgcggacagtacatatgtacaggcattcagaaagatctttaacagtgca
cctactgaaaaaaatctcctgcaggcactggcagcttttgaacgtacgctggaaacagcg
aacagtccttatgacagatacatcaacggcgatgacaatgccatctcagctacggctgct
cggggacgtttgttattcatcggaaaggccaactgtaacaattgtcattcgggtgaagac
ttcactgctgaccgcttcaaaaatataggactatacaacggtactacactgaaagatgcg
gggcgttttgatatcactcacgatagtgcccaactgggattcttcaaggtgccaagctta
cgtaatgtggctgttacagcgccttacatgcacaacggaatgttccggacattgcgtgaa
gtcattgtatactacaacacaccggatgcattaatacatgacggtataaaaagggattta
tcattaaatacgccattgaacttaacagacacagaaatagacgaactggaagcttttctt
aagacacttacagacgaccgttttatcaaccaataa

DBGET integrated database retrieval system