KEGG   Chitinophaga pinensis: Cpin_0876Help
Entry
Cpin_0876         CDS       T00959                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cpi  Chitinophaga pinensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Cpin_0876
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cpin_0876
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Cpin_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1049617..1050150)
Genome map
AA seq 177 aa AA seqDB search
MTMLKTLLISMLLFMKGGAIYDYKVESVDGGKINFADYKGKKILIVNTASMCGNTPQYAE
LEKLYKKYEKNLVIIGFPANNFGQQEPGSNAEIKEFCTKKYAVSFPMAAKISVKGTDIHP
LYKWLAEESKTKHFEPAEVQWNFQKYLLDEKGNLVAVFSPKTQPLSPEVTAAIEKKY
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgctgaagacactcttaatttcaatgctcttgtttatgaaaggaggcgctata
tatgactacaaggttgaatctgtggacggtggtaagatcaatttcgctgattataaaggc
aaaaagatcctgatcgtaaacacagcttctatgtgcggtaacacacctcagtacgctgaa
ctggaaaaactctacaagaaatacgaaaagaatctcgtgatcatcggtttcccggctaac
aatttcggccagcaggaaccaggctccaacgcggagatcaaagaattctgcacaaaaaaa
tacgctgttagcttcccgatggctgccaagatctccgtaaaaggaactgacattcacccc
ctctacaaatggctggcagaagaaagtaaaacaaaacatttcgaacctgctgaagtacaa
tggaacttccagaaatacctgctcgacgaaaaaggtaacctggtagccgtattctctcct
aaaacacaaccactttctcctgaagtaacggccgcgatagaaaagaaatactaa

DBGET integrated database retrieval system