KEGG   Chitinophaga pinensis: Cpin_0876Help
Entry
Cpin_0876         CDS       T00959                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00480  Glutathione metabolism
cpi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Cpin_0876
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cpin_0876
Enzymes [BR:cpi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Cpin_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin RuvX
Motif
Other DBs
NCBI-ProteinID: ACU58374
JGI: Cpin_0876
UniProt: C7PK33
Position
complement(1049617..1050150)
Genome map
AA seq 177 aa AA seqDB search
MTMLKTLLISMLLFMKGGAIYDYKVESVDGGKINFADYKGKKILIVNTASMCGNTPQYAE
LEKLYKKYEKNLVIIGFPANNFGQQEPGSNAEIKEFCTKKYAVSFPMAAKISVKGTDIHP
LYKWLAEESKTKHFEPAEVQWNFQKYLLDEKGNLVAVFSPKTQPLSPEVTAAIEKKY
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgctgaagacactcttaatttcaatgctcttgtttatgaaaggaggcgctata
tatgactacaaggttgaatctgtggacggtggtaagatcaatttcgctgattataaaggc
aaaaagatcctgatcgtaaacacagcttctatgtgcggtaacacacctcagtacgctgaa
ctggaaaaactctacaagaaatacgaaaagaatctcgtgatcatcggtttcccggctaac
aatttcggccagcaggaaccaggctccaacgcggagatcaaagaattctgcacaaaaaaa
tacgctgttagcttcccgatggctgccaagatctccgtaaaaggaactgacattcacccc
ctctacaaatggctggcagaagaaagtaaaacaaaacatttcgaacctgctgaagtacaa
tggaacttccagaaatacctgctcgacgaaaaaggtaacctggtagccgtattctctcct
aaaacacaaccactttctcctgaagtaacggccgcgatagaaaagaaatactaa

DBGET integrated database retrieval system