KEGG   Chitinophaga pinensis: Cpin_0894Help
Entry
Cpin_0894         CDS       T00959                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cpi  Chitinophaga pinensis
Pathway
cpi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpin_0894
DNA repair and recombination proteins [BR:cpi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Cpin_0894
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cpin_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH CoA_binding_3 PHF5 DZR
Motif
Other DBs
NCBI-ProteinID: ACU58392
JGI: Cpin_0894
UniProt: C7PL48
Position
complement(1067113..1067730)
Genome map
AA seq 205 aa AA seqDB search
MIFSSALIENAVNEFARLPGIGKKTALRLVLHLLKQDPAQVKLFGEVVTRMREQIKFCKV
CHNVSDQEVCSICSSPSRNKALVCVVENIRDVMAIENTQQFNGVYHVLGGIISPIDGIGP
EQLNIYSLVDRVQQQGIDEIIMALSPTIEGDTTIYYLSKKLKEFPCKITTIARGIAFGGE
LEYADEMTLARSISNRLPLESYVQK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatattttcctccgcactgatagaaaatgcagttaatgagtttgcgcggctaccgggc
attggcaagaaaaccgccttacgcctggttctacacctgctcaaacaggatcctgcgcag
gtaaaactgtttggtgaagtagtcacccgtatgcgggaacagatcaaattctgtaaagta
tgccacaacgtttccgaccaggaagtatgtagtatatgcagcagtccatcccgcaacaaa
gcactggtctgcgtcgtagaaaacatccgtgacgtaatggccatagaaaatacacaacag
ttcaatggcgtataccatgtactcggcggcatcatctctcctatcgatggtatcggtccg
gagcaactgaatatctattcactggtagacagggtacagcaacaggggattgatgaaatc
atcatggcgctcagccctaccattgaaggcgatacgactatctactatctgtctaaaaag
ctaaaggaattcccttgtaaaatcactacgatcgcccgtggtattgcttttggcggcgaa
cttgaatacgcggatgaaatgaccctggcaagatccatttccaacaggcttccgctggaa
agttatgtgcagaaataa

DBGET integrated database retrieval system