KEGG   Chitinophaga pinensis: Cpin_1016Help
Entry
Cpin_1016         CDS       T00959                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00230  Purine metabolism
cpi01100  Metabolic pathways
Module
cpi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cpin_1016
Enzymes [BR:cpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cpin_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_18 NTPase_1 MobB AAA_19 AAA_16 RsgA_GTPase AAA_30 PRK AAA_33 AAA_14 TsaE T2SSE AAA AAA_24 YodL cobW Rad17 AAA_23 RNA_helicase ABC_tran ATPase_2 SRPRB Zfx_Zfy_act Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ACU58514
JGI: Cpin_1016
UniProt: C7PMH0
Position
1218701..1219267
Genome map
AA seq 188 aa AA seqDB search
MSNKIIIITAPSGAGKTTIVKKLLSELPQLSFSISATTRTARENEVHGRDYYFLSLDDFH
QKIDDNAFAEYEMVYAGKYYGTLKTELQRIWDKEKVPMVDIDVKGALSIKEKYHTGVLTI
FIAPPTLDTLRVRLSERGTETQASLEERLGKARYELSFSHEFDEIVVNDDLETAYTAVKK
LVTGFLGQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataagattattattataactgctccctccggagcaggtaaaaccaccatcgta
aaaaagctgttgtcagaattgccacagctgtctttttctatttcagccacaacgcgtact
gcccgggagaatgaagtgcatggaagggattattacttcctgtcgctggatgattttcac
cagaaaattgatgacaacgcgtttgcagaatatgagatggtgtatgccggtaaatattat
ggtaccctgaaaacagagttacagcgtatatgggataaggagaaagtgccaatggtggat
attgatgtgaagggggctctttccatcaaagaaaaatatcacacgggtgtactgactatt
tttatcgcaccgcctacactggataccttacgggtacgactgagtgaacgtggcacggaa
acgcaggcttccctggaagaaagactgggaaaagcccgttacgagctgtctttctctcat
gaatttgacgaaatagtagtgaatgacgatctggaaacggcttatacagcggttaaaaag
ctggtaaccggattcctcggacagtaa

DBGET integrated database retrieval system