KEGG   Chitinophaga pinensis: Cpin_1016Help
Entry
Cpin_1016         CDS       T00959                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpi  Chitinophaga pinensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cpi00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1218701..1219267
Genome map
AA seq 188 aa AA seqDB search
MSNKIIIITAPSGAGKTTIVKKLLSELPQLSFSISATTRTARENEVHGRDYYFLSLDDFH
QKIDDNAFAEYEMVYAGKYYGTLKTELQRIWDKEKVPMVDIDVKGALSIKEKYHTGVLTI
FIAPPTLDTLRVRLSERGTETQASLEERLGKARYELSFSHEFDEIVVNDDLETAYTAVKK
LVTGFLGQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataagattattattataactgctccctccggagcaggtaaaaccaccatcgta
aaaaagctgttgtcagaattgccacagctgtctttttctatttcagccacaacgcgtact
gcccgggagaatgaagtgcatggaagggattattacttcctgtcgctggatgattttcac
cagaaaattgatgacaacgcgtttgcagaatatgagatggtgtatgccggtaaatattat
ggtaccctgaaaacagagttacagcgtatatgggataaggagaaagtgccaatggtggat
attgatgtgaagggggctctttccatcaaagaaaaatatcacacgggtgtactgactatt
tttatcgcaccgcctacactggataccttacgggtacgactgagtgaacgtggcacggaa
acgcaggcttccctggaagaaagactgggaaaagcccgttacgagctgtctttctctcat
gaatttgacgaaatagtagtgaatgacgatctggaaacggcttatacagcggttaaaaag
ctggtaaccggattcctcggacagtaa

DBGET integrated database retrieval system