KEGG   Chitinophaga pinensis: Cpin_1296Help
Entry
Cpin_1296         CDS       T00959                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00220  Arginine biosynthesis
cpi00330  Arginine and proline metabolism
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01130  Biosynthesis of antibiotics
cpi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Cpin_1296
   00330 Arginine and proline metabolism
    Cpin_1296
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Cpin_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACU58794
JGI: Cpin_1296
UniProt: C7PQA5
Position
complement(1547282..1548199)
Genome map
AA seq 305 aa AA seqDB search
MRNFMIIEAPSNLGLKEPRPGVEPGVRFLPEALRRNGFSREAGITQVINVPAPPYTMDID
PDSQIRNADAICAYSQLLAERVCEAVQKDIIPIVIGGDCSILIGTALGLKSTGGSYGLFS
MDGHHDYMLPFHSGTAGAAGMGLAIVSGNGHPKLCDIHSLRPYIMEQHIYAYGNRELDEE
YVQIIRDSQVHYYDLPSIRARGIQAITTEFLTMMGHSGLDGFWIHLDVDVLDNDVMPCVD
SPEEGGLSYLELEETLIPLVNSGYFKGMHITILDPTLDPDNRYTRTFSERLAHLLRPVVE
GLTVS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatttcatgatcattgaggccccatccaacctgggtttgaaagaaccgcgtcca
ggtgtggaacccggtgtacgttttcttccggaagcactacgccggaacggcttttccaga
gaagccggcatcactcaagttatcaatgttcctgcacctccatatacgatggatatagac
ccggacagccagatccggaatgccgatgccatttgtgcttatagtcagctactggcagaa
agggtttgtgaggccgttcagaaggatattatcccgatcgttataggcggcgactgtagc
atcctgataggtactgccctgggactgaagagtaccggtggcagctacggattgttttct
atggatggacaccatgattatatgttacccttccattccggcactgccggggcggcaggt
atgggcttagcgatcgtatccggcaacggacatcctaaattgtgcgatatccactctttg
cgaccatatataatggagcagcacatctatgcttatgggaaccgtgagctggatgaggaa
tatgtacagattatccgggacagccaggtccattattatgacctgccgtctatccgggcg
agagggatacaagccataacgacggagttcctgacgatgatggggcattcgggactggac
ggattctggatccacctggatgtagatgtactggacaatgatgtcatgccttgtgtggac
agtccggaagagggtggcctctcctacctggaactggaagaaaccctgataccattagtt
aactccggatatttcaaggggatgcatattacgatccttgatcctacactggaccctgac
aaccgatatacacggactttttccgagcggctggcccatctgttgagacccgttgtggaa
ggactgacagtgagttaa

DBGET integrated database retrieval system