KEGG   Chitinophaga pinensis: Cpin_1798Help
Entry
Cpin_1798         CDS       T00959                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cpi  Chitinophaga pinensis
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpi00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cpi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2181816..2183672
Genome map
AA seq 618 aa AA seqDB search
MKKALFCLALCCLVVQAFAQRFNIIPAPVELYEQPGEFIIDKSVVIVAPSAGTQLDSTLQ
WFSDRIATATGFHLKTAKTGTKVLRIVLSQADKQEGYKLKVTPTEITLKAPSPAGVFYGL
QTLLQLLPPDIESSQPIERIWSVPCTDIIDYPRFGWRGLMLDVSRHFYTKEEVKRYIDEM
ARYKYNIFHWHLSDDNGWRIEIKSLPELTKVGAWRVARTGRWGTFESPQPGEPAKEGGFY
TQEDIKEILAYAQARYITVLPEIDVPAHSLAMIAAYPNLSCTQLHYNVNPGSHFYKKEDN
ALCIGNDSVYLVLDKVFTEIAALFPFNYIHVGGDEAYKGFWDNCPKCRKRMEQENLKNVD
ELQSYFVKRLEKILRSKGKKLIGWDEILEGGLAPEATVMSWRGMKGGIEAAKMNHHVVMS
PWEYCYLDLYQGDPAAEPPTYGMCRLSDSYNYDPVPDGVDEKYILGGQGNLWTESIANYR
HIQYMTWPRALALSEVYWSPKAKRNWNKFVQRMEVHFVRFDTAHIKYSRSAWNAIVKPSK
DNNGQLSVQLSTEIKGLDIYYTFDNSDPDNMYPQYTGQPLVFPAGAANLSIVTYHDGKKV
GELLTVGKEELLKRLKDN
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagcattgttttgcctggccttatgctgccttgtagtgcaggcatttgcccag
cggtttaacattatacctgcgccggttgagctatatgaacaaccgggagaattcatcatt
gataaaagtgttgtcatcgttgcaccttcggcaggtacacagttagatagtacactgcaa
tggtttagcgaccgtattgcgacagctactggcttccatctgaaaactgcgaaaacgggg
acgaaggtgctgcgtatcgtgttgagtcaggcagataagcaggaagggtataagctgaag
gttactcctacagagattaccctgaaagctccaagccctgccggtgtattttatggttta
cagacattgttgcaattgttaccaccggatattgaaagcagtcaacccattgaacgtatc
tggtcagtaccctgtacagatatcattgattatccccgttttggctggagaggcttgatg
ttggacgtcagcaggcatttctataccaaagaggaagtgaagcgctatatcgatgaaatg
gccaggtacaaatacaatattttccactggcacctcagtgatgacaatggctggcgtatt
gagatcaaaagtctgccggaactgacaaaggtgggtgcatggcgggtggctcgtaccggc
agatgggggacgtttgaatctccgcaaccaggagagccggcaaaagagggtggtttttat
acccaggaagacataaaggaaatactggcatatgcgcaggcccgctatatcaccgttctg
ccggaaatagatgtaccggcgcatagtctggcgatgatcgcagcttatccgaatctgtcc
tgtacacaattgcactataacgtcaatccgggcagtcatttttacaaaaaagaagataat
gcgctttgtatcggcaatgattcggtatatctcgtacttgataaagtatttacagagatc
gcggcactattccctttcaattatatccatgtgggaggagatgaggcttataaaggcttc
tgggataattgtccgaaatgtcgcaaaagaatggagcaggaaaacctgaaaaatgtggat
gaactgcaaagctattttgtaaaacggttggaaaagatactccggagtaaaggcaaaaaa
ctcattggatgggacgagatcctggaaggcggattagcgccggaggcgaccgttatgagc
tggagagggatgaaaggagggatagaagcagctaagatgaatcaccatgtggtcatgagc
ccctgggagtattgttacctggacctctaccagggagatcctgctgcggagccgcctacc
tatggtatgtgcagactgagtgattcatacaactatgatccggtaccggatggtgtggat
gaaaagtatattctcggcggacagggaaatctctggacggaatccatcgctaactatcgt
catattcagtatatgacctggccacgcgcattggcattgtcagaggtttactggagtcct
aaagccaaacgtaactggaataagtttgtgcagagaatggaagtgcattttgtaagattt
gacactgcgcatattaaatactcccgtagcgcctggaacgctattgtaaaaccgtcaaaa
gataataacggacaactgtccgtgcaactgtccaccgaaattaaaggactggatatttac
tacacatttgataattctgatccggataatatgtatccgcaatacaccggacagcccctg
gtatttccggcaggcgcagcaaacctgagtatcgttacttaccacgatgggaaaaaggta
ggagaactactgaccgttggtaaagaagaattgttgaaacggctaaaagataactga

DBGET integrated database retrieval system