KEGG   Chitinophaga pinensis: Cpin_1812Help
Entry
Cpin_1812         CDS       T00959                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cpi  Chitinophaga pinensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cpi00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2215739..2216719
Genome map
AA seq 326 aa AA seqDB search
MKKCFLIILFPFFLFLTASLRAQDPRARLVVAADGTGDYKTIQEAVNAVRDFTLFRVTIF
IRKGIYHEKLCIPSWKCTITLQGEDRDSTVITNADYSGKVYPGKDASGRDKFGTFTSYTV
LVAGDDIIAENLTFENAAGPVGQAVALHVEGDRCRFRNCRLLGNQDTLYAGKEDSRQYYQ
DCYIEGTTDFIFGAATVWFEGCTIHSKRDSYITAASTTQRQPYGFVFNHCKLTADSVAKK
VFLGRPWRPYAATVFMNSILGPQILAQGWHNWDKKENELTARYAEYHNTGAGATHDKRVA
WSRQLPAQSAKDITLTKVFGNWDPLK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatgctttcttataattttgtttccgttttttttgttcttaactgcctccctg
cgcgcacaggatccccgtgctcgtctggtagtggcagcggatggaacaggcgattataag
acgatccaggaggcggtgaatgcagtcagggattttactttattccgggtgactattttt
atccgtaaaggtatatatcacgaaaagctatgtattcccagctggaaatgtacaattacc
ttacagggggaggacagggacagtacggtcattaccaatgcagattattcaggaaaagta
tatcctgggaaggatgcatccgggagggataaattcggcacatttacctcttatactgta
ttggtagccggagacgatatcattgccgaaaacctcacttttgaaaatgctgcgggtccg
gtaggacaggcagttgcgcttcatgtggaaggggatcgttgccggttccgtaattgcagg
ttgctgggcaaccaggataccttatatgccggaaaagaagatagcaggcagtattaccag
gattgttacatagaaggcacgaccgattttatattcggtgctgcgacggtatggtttgaa
ggctgtacgatccacagtaaaagagattcttacattacagccgcttctacgacacaacgg
caaccttacgggtttgtattcaaccattgtaaattaaccgcagacagcgtcgctaaaaag
gtgtttctggggcgtccctggagaccttatgcagcaactgtctttatgaacagcatcctg
gggccgcagatactagcgcagggctggcataactgggataagaaagaaaatgaactgact
gcgagatatgctgagtatcataatacgggtgccggcgcaacgcatgataagcgtgtggcc
tggtcccggcagttaccggcgcagtcggcaaaagatattacactcactaaagtatttggc
aattgggatccgttaaagtaa

DBGET integrated database retrieval system