KEGG   Chitinophaga pinensis: Cpin_1825Help
Entry
Cpin_1825         CDS       T00959                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpi01100  Metabolic pathways
cpi01110  Biosynthesis of secondary metabolites
cpi01130  Biosynthesis of antibiotics
cpi01230  Biosynthesis of amino acids
Module
cpi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpin_1825
Enzymes [BR:cpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cpin_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Thioredoxin_5
Motif
Other DBs
NCBI-ProteinID: ACU59321
JGI: Cpin_1825
UniProt: C7PAU9
Position
2229981..2230781
Genome map
AA seq 266 aa AA seqDB search
MKNILTEIVAHKHVEVAARKQQRSVEELEQASWFKCTSLSLAQFLQDPAKTGIIAEFKRR
SPSKGLINGDVTVQDVTTAYTRYGASGLSVLTDEKFFGGSSDDLQQARILNNIPILRKDF
IVDEYQIVEAKAIGADVILLIAECLTKAEVAQLAKFAHNLGLEVLLEVHSGDQLEKVTDH
IQLVGVNNRDLTTFNVDFNRSCELAPQIPADKCKVAESGISNTDAILTLKAAGFQGFLIG
EHFMRQENPPRAFEQFVTELANKSAK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatccttacagaaatagtagcccataagcatgtggaagtggcagcccgcaaa
caacagcggagtgtggaagagctggaacaggcatcctggtttaagtgcacctctttgtca
ctggcgcagtttctgcaggatcctgcaaagacaggtatcattgcagagttcaaaaggcgt
tctccttcaaaaggattgatcaacggcgacgtaaccgtacaggacgtgaccactgcttat
acccgctatggtgcatccggattatcagtactgacagatgagaaattcttcggtggttct
tctgatgatctgcaacaggcgcgtatactgaataatattccgatcctgcgtaaggacttt
atcgtagacgagtatcagattgtcgaagcaaaagcgatcggtgctgacgtgatcctgctg
attgcagaatgtctcacaaaagcagaagtggcccagctggcgaagtttgcccacaatctc
ggactggaagtattgctggaagtacatagcggcgatcagctggaaaaggtgactgatcat
atacagctggtaggtgtgaataaccgggatctgacaacgttcaatgtcgactttaaccgt
tcctgcgaactggcgccacagatacctgcagataaatgtaaagtagcagaaagtggtatc
agtaatacagatgcaatccttacgctgaaagcagcaggtttccagggattcctgatcgga
gaacatttcatgcggcaggaaaatccaccgagagcatttgaacaatttgtaacagaactg
gccaacaaatcagcaaaatga

DBGET integrated database retrieval system