KEGG   Chitinophaga pinensis: Cpin_1827Help
Entry
Cpin_1827         CDS       T00959                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpi  Chitinophaga pinensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpin_1827
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpin_1827
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpin_1827
Enzymes [BR:cpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpin_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2231421..2232647
Genome map
AA seq 408 aa AA seqDB search
MKIAENTFGSKYHVDEKGFYGRFGGAYIPEMLFPNVDELQRNYLEILKDPSFQQEFDQLL
RDYVGRPSPLYFAKRLSEKYKAKIYLKREDLNHTGAHKVNNTIGQILLAQRLGKTRIIAE
TGAGQHGVATATVCALMGLECVVYMGSIDIQRQAPNVARMKMLGATVVPATSGSQTLKDA
CNEAIRDWINNPVDTHYILGTAAGPHPYPDMVTRFQSVISEEIKKQLLEKTGKENPDYVM
ACIGGGSNAAGAYYHFLDEPDVKLIAIEAGGKGVHSGHSAATTQLGKLGIIHASKTLLMQ
TEDGQITEPYSISAGLDYPGIGPLHSHLYETGRATFLNATDDEALQAAYELTRLEGIIPA
LESSHALAKLGQVAFKPDDVVVVCLSGRGDKDMETYIRNLPANTGGNV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagcggaaaacacgttcggctctaagtatcatgtagatgaaaaaggcttttac
ggcagatttggcggcgcttacattccggagatgttgtttccgaatgtagacgagctacag
cgtaattacctggagatcctgaaagatccttcctttcagcaggagttcgatcaactgctg
cgcgattatgtaggacgcccttctcccttgtattttgcaaaacgtttgtctgaaaaatat
aaggcaaagatctatctgaaacgtgaagatctgaaccataccggtgcacataaagtgaat
aacaccatcggacagatcctgctggcacaacgcctgggtaagacgcgtatcattgcggaa
accggtgctggtcagcatggggtagcaacagctaccgtatgtgcgctgatgggactggag
tgtgtagtgtatatgggtagtattgacattcagcgccaggcgccgaatgtggcccgtatg
aaaatgctgggtgctacagtggtacctgccacaagtggtagtcagacactgaaagacgcc
tgtaatgaggcgatccgcgactggattaacaatccggtagatacgcactatatactggga
acagctgctggtccgcatccatatccggatatggtaacccgctttcagtctgtgatcagt
gaagaaataaagaaacagttactcgaaaagaccggcaaggaaaaccctgactacgtaatg
gcttgtatcggtggcggtagtaacgctgctggtgcttactatcacttcctggatgaaccg
gatgtgaaactgattgcgatagaggcaggtggtaaaggtgtacattccggtcattcagca
gcgactacgcagctgggtaaactgggtatcattcacgccagcaagacattgctgatgcag
acagaagacggacagatcactgagccttattctatttctgccggattggattatccgggt
attggtcctctgcattcgcatctttatgaaaccggtcgtgctactttcctgaatgcgact
gatgatgaagccttacaggcagcttatgagctgacccgtctggaaggaatcattcctgca
ctggaatcctctcatgcactggcaaaactcggacaggtagccttcaaaccagatgatgtg
gtggtggtgtgtctgagtggccgtggtgataaggacatggaaacatacattcgtaatttg
cctgctaacactggtggtaacgtataa

DBGET integrated database retrieval system