KEGG   Chitinophaga pinensis: Cpin_1828Help
Entry
Cpin_1828         CDS       T00959                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpi  Chitinophaga pinensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cpin_1828
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cpin_1828
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cpin_1828
Enzymes [BR:cpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cpin_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2232657..2233433
Genome map
AA seq 258 aa AA seqDB search
MSNRIDQLFAGKKTGVLNIYCTAGFPELNDTLPVMQSLQQHGADMIELGMPFSDPLADGP
VIQDSSTRAIKNGMSLKVLFEQLKDFRQHIHLPVLLMGYLNPVLLYGIEEFCKKCAEVGV
DGVILPDLPMNEYEQEYKPVFEKYNLHLIFLVTPETSEERIKKIDSVSKGFVYAVSSSST
TGKDKDMGHQQVYFERLKALALKNPVLIGFGIKDKATFDAAASNSNGGIIGTAFIRAIEN
TTNLDTTIKEFIAGVKHN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgtatagatcaattatttgccggcaaaaaaacgggtgtactgaacatctac
tgcacagcaggatttcctgaactgaacgatacgctgcctgtcatgcaatctttacaacag
catggggccgatatgatagaactgggtatgccattctctgatccgctggctgacgggccg
gtgatccaggatagtagcacccgcgccattaagaatggtatgagtctgaaagtgctgttt
gaacagctgaaagatttcagacaacatatccacctgccggttttactgatggggtatctt
aatccggtgttactgtacggtattgaggaattttgtaaaaaatgtgccgaagtgggtgtg
gatggtgttatactgcctgacttaccgatgaacgaatatgagcaggagtataaacctgta
ttcgaaaaatacaacctgcacctgatcttcctggtaacgccggaaacgagtgaggaaagg
atcaaaaagatcgatagtgtaagtaaaggttttgtatatgcggtatcctcttcttccact
acagggaaggataaggacatggggcatcagcaggtatatttcgaaagactgaaagcactc
gccctgaagaatccggtgctgatcgggtttggtatcaaagataaagctacctttgacgct
gccgcatccaacagtaatgggggaattatcggtactgcctttatccgcgcaattgaaaat
acgaccaacctggatactacaataaaagaatttattgcaggcgtaaaacacaactag

DBGET integrated database retrieval system