KEGG   Chitinophaga pinensis: Cpin_2009Help
Entry
Cpin_2009         CDS       T00959                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cpi  Chitinophaga pinensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2449519..2451765)
Genome map
AA seq 748 aa AA seqDB search
MKKNGSNLSFRLAALLLCLLGFSSQTHAQTPVQKNGQLQVIGTKLCNQYGNPIQLRGMST
HGIQWYGWGSCLTAASLDALAYDWGADILRISLYVQEGGYETDPTGFTNQVNRLIEEATA
RGMYALVDWHQLTPGDPNANLARAKTFFSAIANTHKNKNNIIYDICNEPNSGATWAKIKT
YADQMIPFIRAIDNDAVILVGTHGWSTMGLSGDGSLQDIFNNPLTHGNVMYTFHFYAKDH
RTAYLNQLNTASDRLPVFVTEFGTQEASGDGANDFAMAQQYIDLMARKKISWTNWNYSDD
FRSGAVWITGTCSNGPWTTARLKPAGAWIRERILNPADDFPGGNVCVPVSASANDGNVPA
NVQDNDYNTRWSAEGDGQWIQFCLDNTTTVSGVNIAFYSGTVRRTFFDILTSTDGSNWVS
AASGLQSSGTSNALEAFTFTPRSAKHVRIVGHGNSASAWNSLTEVRIITTSSTQQSTLAP
LQDAYVRNGDYAAITHGTTDATVLASKINATATTGYDRQSFLRFDVSGVNNISSAVLKVY
GKIEDNRVANLPIGVYAVANTSWTESALTWNNKPATGSTALQTAVVTDSVGRYYSWDITN
YVQTEKAAGRNGISLALLSNTGADPRVIWRSKEAGLTAPQLVIASTPTAAKLAASAPEKA
PVKLITTLTSYPNPFDDNSTVSFFLDKPADVLLAVYDINGKQVAILKRGRLDAGQYNTSL
AASHLPKGIYTLKLTYGEKAITRKVVKQ
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaatggatctaacctttctttccggctggctgcattattactatgcctgctg
gggtttagttcacaaacacacgcacagacgcccgttcagaaaaacggtcagttgcaggtg
atcggtactaaattatgcaatcagtatggcaatccgatccagctcagaggcatgagcaca
catggtatccaatggtatggctggggaagctgtctgacagctgcttcactcgatgcgctg
gcatacgactggggcgccgacatcctgcgtatctcactctatgtacaggaaggcggttat
gaaaccgatcctaccggctttaccaatcaggtgaaccgcctcatagaagaagctaccgca
cgtggtatgtatgcactcgttgactggcatcagctcacaccaggcgatcctaacgccaac
ctggccagagcaaagactttcttctctgccatcgccaacacacacaagaacaaaaacaac
atcatctacgacatctgtaatgagcccaactcaggcgcaacctgggcgaagatcaaaact
tacgcggatcagatgattccgtttatacgcgctatcgacaatgacgccgtcatactcgta
ggtacacacggatggtctactatgggcctctccggtgatggttcgctgcaggatattttc
aacaatccgctgacacatggtaacgtgatgtatacattccatttctatgcaaaagatcat
cgtaccgcatatctcaatcagctgaatactgcttctgacagactgcctgtcttcgtaaca
gaattcggtacgcaggaagccagcggagacggcgctaatgactttgccatggcgcaacag
tacatcgatctgatggcacgtaagaagatcagctggaccaactggaactactctgacgac
ttccgttccggcgctgtatggataacaggtacctgctccaatggcccgtggacaaccgcc
agactaaaacctgccggcgcatggatacgtgagcgtatactgaatcctgcggatgatttt
ccaggaggaaatgtatgtgtgccggtatctgccagcgcaaacgatggtaacgtaccagcc
aacgtacaggataatgattataacacccgctggtcagcagaaggcgacggtcagtggata
caattctgcctggacaacaccactactgtaagcggtgtcaatattgcattctatagtggt
actgtaagacgcaccttcttcgatatcctgaccagcacagatggcagcaactgggtatcc
gcagcaagcggtctgcaaagcagcggtacctccaatgcattggaagcattcaccttcaca
ccacgtagtgcaaaacatgtacggatcgtgggtcacggtaacagtgcaagtgcctggaat
agtctgacagaagtacgtatcattaccacttcttccacacaacaatcaacactcgcacct
ttacaggatgcgtatgtaagaaacggcgactacgcagctattacacatggtactactgat
gcaacagtattggcatctaaaataaacgcaacggctactacaggctacgacagacaaagc
ttccttcgctttgatgtaagtggtgttaacaacatctcttctgccgtgttaaaagtatat
ggtaaaattgaagataaccgcgttgcgaatctgccaataggcgtgtatgcagttgctaac
acaagctggacagaatccgcactcacctggaataataaacctgctacaggtagcactgca
ttacagacagccgtagtgactgactcagttggcagatactattcatgggatatcaccaac
tatgtacagacggaaaaagcagccggacgtaatggtatttccctggcattactgagcaat
accggcgctgatccacgtgtcatctggagatctaaggaagcaggactgacagctcctcag
ctggtgatcgcttccactccaacagccgctaaactggcagccagtgcaccagaaaaagca
cctgtaaaactgattactacactgaccagttatccaaatccattcgatgacaacagcacc
gttagtttcttcctggataaaccagcagacgtattactggcggtatatgacatcaatggt
aaacaagtggcaatactgaaacgcggccgtctggatgcgggtcaatacaataccagcctc
gcagccagccatctgccaaaaggtatttatacactgaaactgacctatggagagaaggca
ataacaaggaaggtagtgaaacaataa

DBGET integrated database retrieval system