KEGG   Chitinophaga pinensis: Cpin_2049Help
Entry
Cpin_2049         CDS       T00959                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cpi  Chitinophaga pinensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2497575..2498741
Genome map
AA seq 388 aa AA seqDB search
MSKKNIAIFGSTGSIGIQALEVIEAHPDKFSVEVLTGGQNANLLIEQALKFRPNAVVIAD
ETQYEKVKDALFDKGIKVFAGAKAMVEVAAWNTIDMMLAAVMGFAGLAPTLAAIEQGTPI
ALANKETLVVAGDIVMAAANKRNVPVVPVDSEHSAIFQCLLGEDLRKVDKVILTASGGPF
LGKKPNFLINVKKDHALQHPNWRMGAKITIDCATLMNKGLEMIEARWLFNLPPEKIEVVI
HPQSIIHSMVEFVDGSLKAQLGVPDMKLPIQLALGFPERLANDFPKFSFKNNPTLTFEQP
DTKTFRNLAIAIEAMHKGGNAACVMNAANEEVVHAFLKNRIGFLQMTEVIEETMAKIAFV
EKPTLHDYYESDQAAREYANSMINAIVI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaagaacatagccatctttggctccacaggatctattggcatccaggcattg
gaggtgattgaagcacatcctgacaagttcagcgtggaagtattgacgggggggcagaat
gccaaccttttaatagaacaggctttaaaatttcgtccgaatgcggtggtaatagccgat
gaaacacagtatgagaaggtgaaggacgcattattcgataaaggtatcaaggtatttgcg
ggtgcgaaagccatggtggaagtagctgcctggaatacaattgatatgatgctggcggct
gtaatgggctttgccggtctggcgccgactctggctgccattgaacagggtacgccgatt
gccctggcaaataaagaaaccctggtagtggcaggcgatatcgtgatggcagcagccaac
aagcggaatgttcctgtcgtacctgtagattctgaacactcagctatatttcagtgtctg
ttaggcgaagacctgcggaaagtggataaagtaatcctgactgcttccggtggtcctttc
cttggtaaaaagcctaatttcctgatcaatgtgaaaaaagatcatgcgttgcagcatcct
aactggagaatgggcgcgaagatcaccattgactgtgcaacactgatgaataaaggcctg
gaaatgattgaggcccgttggttattcaatctgccgcctgaaaagatcgaggtagtgata
catccgcagtcgatcattcactctatggtggaatttgtggatggttcgctgaaagcgcag
ctgggcgtacctgatatgaaattgccgatacaactggctttaggatttccggaaagatta
gccaacgatttcccgaaattctctttcaagaataatcctacgctgacatttgaacagcct
gataccaagactttccgtaacctggccattgctattgaggcaatgcacaagggaggaaat
gcagcctgtgtcatgaacgctgcaaatgaagaagtggtacatgctttcctgaagaacagg
attggtttcctgcagatgacggaggtgatagaagagacgatggcgaagattgcatttgta
gaaaaacctacattgcatgactattatgaaagcgatcaggctgccagggaatatgcaaat
tccatgatcaatgctatagtgatttaa

DBGET integrated database retrieval system