KEGG   Chitinophaga pinensis: Cpin_2169Help
Entry
Cpin_2169         CDS       T00959                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpi  Chitinophaga pinensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cpin_2169
Enzymes [BR:cpi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cpin_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2653915..2655720
Genome map
AA seq 601 aa AA seqDB search
MHTINDVHQQFAEYFQIPALKPYAYLLSRKLSEGHICLHLNKPVEAAADLPAFCENMPTG
SRTLQQIPLVAKGGNDSQPFVLYQERLYLQRYFRYETIFLQRIHQFLATEKEVLADRLKM
LETHRTFISNLFAAGPAFVADGGDPADWQLSAAVTGVLNNFTIITGGPGTGKTTTVAKIL
AILYYLDPSLKVALAAPTGKAAARMAESLRNTQLPVDDAITAQFRSLAPSTIHRLLRSRK
DSPYFVYNRENPLNYDVVILDECSMIDVALFAKLLDAVGNGTRLILLGDKDQLASVEAGS
LFGDLCQAQDALNMFTKERLALINSFIPDERRKLPDSQIKANDPHPLFQHLVELRRSHRF
SGDKGIGKFSKAIIANDQVAIHGFLAPGADEQVVIDETYSKELFAQFVAGYSAFIVEKDV
RKALQLLNDLRVLCAIREGEEGLYAINRNIEKILHDKRLIRVNAEFYENRPVILTRNYYE
HGLFNGDTGIIRTDEQGVLMAWFEDSNGELKAILPGYLTEAETVFAMTIHKSQGSEFKEV
MVILPRAKDVPILTRELLYTGVTRAKQKVYVQSSAEVLLLTATRFVERASGIGQRFADDR
P
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaatcaacgacgtccaccaacagtttgcagaatatttccagataccggcctta
aagccgtatgcttacctgctttcgcgaaaactcagcgaagggcatatctgcctgcacctg
aataaaccggtggaggctgctgccgacctgccggcattctgtgaaaatatgcccactggt
agcagaactttacaacagattccactggtggcaaaaggagggaatgacagtcagcctttt
gtgttgtaccaggagcggttgtacctgcaacggtatttccggtatgagaccatcttcctg
caacgcattcaccagtttctggctacggaaaaggaagtactggccgacagactgaaaatg
ctggaaacccaccgtacttttatcagtaacctgtttgctgccggaccggcatttgtagcc
gatggtggcgatccggctgactggcagctcagtgctgcagtgacgggtgtactgaacaat
tttacgattatcaccggtggtcccggtacaggaaaaaccaccacggtggctaaaatactc
gcgatactctattacctggatccttccctgaaggtagccctggcggcgccgaccggtaag
gcggctgcacgtatggcagaaagcttgcgtaatacgcagttacctgtggatgacgccatc
accgcacagttccggagtctggcgccgagtaccattcaccgcttactacgctccaggaaa
gacagtccctattttgtgtataacagggagaatccgctgaactatgacgtggtaatcctg
gatgaatgttccatgatcgatgtggccctgtttgccaaattgctggacgctgtcggtaat
ggtacccgactcatattactcggcgataaagaccagctggcttctgtagaagcaggtagt
ttgtttggtgatctctgtcaggcacaggacgccctcaacatgttcactaaagaacggctt
gcgctgattaattcctttattcctgatgaaagaagaaaattgcctgacagtcagatcaaa
gcaaatgatcctcatcctttgtttcagcatctagttgagttacgtcgtagccatcgtttc
agcggagacaaggggatcggtaaattcagtaaggccatcattgcaaacgatcaggtggcc
atacatggctttcttgcaccgggtgcagatgaacaggtcgtaatagatgaaacctattca
aaggagctgtttgcgcaatttgtagccggttacagcgcctttattgtggaaaaggatgtc
cgcaaagcattacagctgctcaatgacctgcgtgtcttatgtgcgatcagggaaggagag
gaaggcttgtacgctatcaacagaaacatagaaaagatcctgcacgataaacgtctgatc
cgtgtgaatgctgaattctacgagaacagacctgtgatattgacccgtaactactatgaa
cacggtctctttaacggagataccggtattatccgtacggatgaacagggtgtgctgatg
gcctggtttgaagacagtaacggtgaactgaaagcgatcctgccaggatacctgacagaa
gcagaaaccgtatttgctatgaccattcacaaaagccaggggtctgagtttaaggaagta
atggtgatcctgccacgcgcaaaagatgttcctattctgacaagagagttgctctatact
ggtgtaaccagggcgaaacagaaagtgtatgtacagtcatcagcagaggtcttgttactg
actgcaacacgttttgtggaaagagcttcgggtatcggacagcgttttgcagacgatcgc
ccctga

DBGET integrated database retrieval system