KEGG   Chitinophaga pinensis: Cpin_2331Help
Entry
Cpin_2331         CDS       T00959                                 

Definition
dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpi  Chitinophaga pinensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpin_2331
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpin_2331
  Amino acid metabolism
   00310 Lysine degradation
    Cpin_2331
Enzymes [BR:cpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cpin_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2872789..2874219
Genome map
AA seq 476 aa AA seqDB search
MAIVELVMPKMGESIMEATILRWHKKPGDQVKADETVLEIATDKVDSEVPSIADGEITEI
LYAENDVVPVGTVIARINTTADAGFATAAPVAPPAAQSAPVAASEEVHVVTNEPASAPYE
AQFVTSGARFYSPLVLTIAQQEGISFAELEKIPGTGNEGRVTKKDILNFVEAKSKGHVPA
AAPVQQQETAAPVEQPVSRPAATTPVAAVPTTAPASNNGVAAPPTTQQPTSAPISMGSYT
GNVEIIEMDRMRKLIAEHMVRSKHTSPHVTSFAEADVTNMVKWRDQIKKEFEKREGEKIT
FTPLFIEALVRCIKKYPLLNSSLEGDKIILKRDINVGMATALPSGNLIVPVIRNADMLNL
VGLTRQVNHLANAARQNKLKPDDTQNGTITLTNVGSFGSLAGTPIINQPQVAILAVGAIK
KRPVVIETPHGDTIAIRHMMYLSMSYDHRIVDGALGSTFLSAVAHELEHFNPEREY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggccattgtagaactggtaatgcccaaaatgggggaaagtattatggaagccaccata
ttacgttggcataagaagccgggagatcaggtaaaagctgatgaaaccgtgcttgaaatt
gcaacggataaggtggatagcgaagtaccttctattgccgatggggagattaccgagata
ctctacgcagaaaatgacgtcgtaccggtaggtactgtcatagcacgtatcaatactact
gctgatgccggctttgcaactgcagctccggtagcgccaccggctgcacagtccgcgcct
gttgccgcaagtgaagaagtacatgttgtaacaaatgaacctgcaagcgctccttatgaa
gcacagtttgtgacgagcggcgcccgtttctattctccactggtgctgacaattgcacaa
caggaaggcatcagtttcgccgaattggaaaaaataccaggtaccggcaatgaaggtcgt
gttaccaagaaagatatcttaaacttcgtagaagctaagagcaaagggcatgttcctgct
gctgcacctgttcaacaacaggaaactgcggctccggtagaacagcctgtaagccgtccg
gctgctacgacgcctgttgctgctgttccgacaacagcgccggccagcaacaatggagtg
gctgctccgccgactacacaacagccgaccagcgcacctataagtatgggtagctacact
ggtaatgtggaaatcattgaaatggatcgtatgcgtaagctgatcgcagagcatatggtg
cgtagtaaacataccagtccgcatgtaaccagctttgcagaagcagacgttaccaacatg
gtgaaatggcgtgatcagattaagaaagagttcgaaaaaagagaaggagagaagatcact
tttacaccactctttatcgaggcactggtaagatgtatcaagaaatatcctttgctgaac
agctctctggagggtgataagatcattctgaaaagagatatcaatgtcggtatggctaca
gcgttaccatctggtaacctgatcgttccggtgatccgcaatgcagacatgctgaacctg
gtagggttgacccgtcaggtaaatcatctcgcgaatgctgcccgtcagaacaagctgaaa
cctgatgatacgcaaaacggtaccatcaccctgactaacgttggttcttttggtagtctg
gcaggtacgccgattatcaaccagccacaggtagccatcctggcggtgggagctattaag
aagcgtcctgtggtgattgaaacaccacatggcgataccatcgctatccgtcacatgatg
tatctgtcaatgtcttacgatcaccgtatcgtggatggcgcattgggatctactttcctg
agtgctgtagcacatgaactggaacatttcaatcctgaaagagagtattaa

DBGET integrated database retrieval system