KEGG   Chitinophaga pinensis: Cpin_2331Help
Entry
Cpin_2331         CDS       T00959                                 

Definition
dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpi  Chitinophaga pinensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cpin_2331
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cpin_2331
  Amino acid metabolism
   00310 Lysine degradation
    Cpin_2331
Enzymes [BR:cpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cpin_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2872789..2874219
Genome map
AA seq 476 aa AA seqDB search
MAIVELVMPKMGESIMEATILRWHKKPGDQVKADETVLEIATDKVDSEVPSIADGEITEI
LYAENDVVPVGTVIARINTTADAGFATAAPVAPPAAQSAPVAASEEVHVVTNEPASAPYE
AQFVTSGARFYSPLVLTIAQQEGISFAELEKIPGTGNEGRVTKKDILNFVEAKSKGHVPA
AAPVQQQETAAPVEQPVSRPAATTPVAAVPTTAPASNNGVAAPPTTQQPTSAPISMGSYT
GNVEIIEMDRMRKLIAEHMVRSKHTSPHVTSFAEADVTNMVKWRDQIKKEFEKREGEKIT
FTPLFIEALVRCIKKYPLLNSSLEGDKIILKRDINVGMATALPSGNLIVPVIRNADMLNL
VGLTRQVNHLANAARQNKLKPDDTQNGTITLTNVGSFGSLAGTPIINQPQVAILAVGAIK
KRPVVIETPHGDTIAIRHMMYLSMSYDHRIVDGALGSTFLSAVAHELEHFNPEREY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggccattgtagaactggtaatgcccaaaatgggggaaagtattatggaagccaccata
ttacgttggcataagaagccgggagatcaggtaaaagctgatgaaaccgtgcttgaaatt
gcaacggataaggtggatagcgaagtaccttctattgccgatggggagattaccgagata
ctctacgcagaaaatgacgtcgtaccggtaggtactgtcatagcacgtatcaatactact
gctgatgccggctttgcaactgcagctccggtagcgccaccggctgcacagtccgcgcct
gttgccgcaagtgaagaagtacatgttgtaacaaatgaacctgcaagcgctccttatgaa
gcacagtttgtgacgagcggcgcccgtttctattctccactggtgctgacaattgcacaa
caggaaggcatcagtttcgccgaattggaaaaaataccaggtaccggcaatgaaggtcgt
gttaccaagaaagatatcttaaacttcgtagaagctaagagcaaagggcatgttcctgct
gctgcacctgttcaacaacaggaaactgcggctccggtagaacagcctgtaagccgtccg
gctgctacgacgcctgttgctgctgttccgacaacagcgccggccagcaacaatggagtg
gctgctccgccgactacacaacagccgaccagcgcacctataagtatgggtagctacact
ggtaatgtggaaatcattgaaatggatcgtatgcgtaagctgatcgcagagcatatggtg
cgtagtaaacataccagtccgcatgtaaccagctttgcagaagcagacgttaccaacatg
gtgaaatggcgtgatcagattaagaaagagttcgaaaaaagagaaggagagaagatcact
tttacaccactctttatcgaggcactggtaagatgtatcaagaaatatcctttgctgaac
agctctctggagggtgataagatcattctgaaaagagatatcaatgtcggtatggctaca
gcgttaccatctggtaacctgatcgttccggtgatccgcaatgcagacatgctgaacctg
gtagggttgacccgtcaggtaaatcatctcgcgaatgctgcccgtcagaacaagctgaaa
cctgatgatacgcaaaacggtaccatcaccctgactaacgttggttcttttggtagtctg
gcaggtacgccgattatcaaccagccacaggtagccatcctggcggtgggagctattaag
aagcgtcctgtggtgattgaaacaccacatggcgataccatcgctatccgtcacatgatg
tatctgtcaatgtcttacgatcaccgtatcgtggatggcgcattgggatctactttcctg
agtgctgtagcacatgaactggaacatttcaatcctgaaagagagtattaa

DBGET integrated database retrieval system