KEGG   Chitinophaga pinensis: Cpin_2364Help
Entry
Cpin_2364         CDS       T00959                                 

Definition
GDP-mannose 4,6-dehydratase
Orthology
K01711  
GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
cpi  Chitinophaga pinensis
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cpin_2364
   00520 Amino sugar and nucleotide sugar metabolism
    Cpin_2364
Enzymes [BR:cpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     Cpin_2364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2907080..2908177
Genome map
AA seq 365 aa AA seqDB search
MKVALITGVNGQDGAYLAELLLEKGYMVHGIKRRASLLNTDRIDHLYQDPHSENVRFRLH
YGDMTDSTNLIRIIQETQPDEIYNLAAMSHVKVSFDTPEYTANADGIGTLRILEALRILK
LEHKTKVYQASTSELYGLVQEVPQRETTPFYPRSPYAVAKLYAYWITVNYREAYGMFACN
GILFNHESPLRGETFVTRKITRAVAAIALGLQDKLYLGNLDAQRDWGHAKDYVEAMWRIL
QQDTPDDYVIATGITTPVREFVRMAFDELGIELKFEGTGVAEVAYVSACRNKEFILPIGK
QVLAVDPAYFRPTEVELLIGDPTKSKTKLGWEPKYDLQELVSEMVTCDVEIFRKDSKTQW
EQLAG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgctttaatcaccggtgtaaatggacaggacggtgcgtacctggcagagttg
ctgcttgaaaagggatacatggtgcatggtattaaacgccgtgcgtctttgctgaataca
gacagaattgaccatttatatcaggatcctcatagtgaaaatgttcgtttcagattacac
tacggtgatatgaccgatagtactaacctgatccgtatcatccaggaaactcaacctgac
gagatttacaatctcgctgctatgagccatgtgaaagtaagttttgatacaccggaatat
actgcgaatgcagatggtataggcactctgcgtatactggaggcactgcgcattctgaaa
ctggagcataaaacaaaagtatatcaggcgagcacttctgagctgtatggtctggtacag
gaagtaccacagagagagacgactcccttctacccacgcagcccgtatgccgttgctaaa
ttatatgcttactggatcaccgttaactatagagaagcatacggtatgtttgcctgcaac
ggtatcctgtttaaccatgaaagtccgctgcgtggcgaaactttcgtaacacgtaagatc
acccgtgcagttgcagcgatcgcactgggtctgcaggataagctgtatctgggtaacctg
gatgcacagcgtgactggggacatgcgaaagactatgtagaagcaatgtggagaatcctg
cagcaggatacaccagatgattatgtgatcgcaaccggtattactacacctgtgcgtgaa
tttgtacgcatggcgtttgatgaactgggtatcgaactgaaatttgaaggtacaggtgtt
gcagaagtagcttatgtaagcgcctgccgcaataaagaattcattctgccaatcggcaaa
caggtactggcggtagatccggcttacttccgtcctacagaggtggaactgctgataggc
gatcctaccaagtctaaaacaaaattaggctgggaacctaaatacgatctgcaggagctg
gtaagcgaaatggtaacctgtgacgtggaaatattcagaaaggacagtaaaactcagtgg
gaacaattggcaggataa

DBGET integrated database retrieval system