KEGG   Chitinophaga pinensis: Cpin_3094Help
Entry
Cpin_3094         CDS       T00959                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpi  Chitinophaga pinensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cpin_3094
Enzymes [BR:cpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cpin_3094
Exosome [BR:cpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cpin_3094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3811277..3813217
Genome map
AA seq 646 aa AA seqDB search
MTVNKKSKLQPVVPFSLLSARDVELFQEGTHAHLYEKFGAHTLEYEGVKGTYFAVWAPNA
AYVSVIGDFNEWDHYSHTLYPRWDKSGIWEGFIPQVKKGALYKYFIRSNSGEELRKGDPY
ANYWEQRPLTASVTWQLDYKWKDKRWMEQRHKHNSLESPFSVYEVHLGSWRRPDKSNHEL
FYTYAEIAAMLVPYVKDMGFTHVELMPVMEHPFDGSWGYQGTGYYAPTSRYGSPQDFMAF
VDAFHHAGIGVILDWVPSHFPYDAHGLYRFDGAHTYEYADMRKGYHPDWNSYIFNYARSE
VRSFLLSNAVFWLEKYHIDGLRVDAVASMIHLNYSREAGAWEPNELGGEENLEAVSFLKH
MNETIYKLFPDVQTIAEESTNFYGVSRPVYMGGLGFGMKWMMGWMNDTLAYFKRDPYHRK
WHQDQLTFSIAYAFTENFMLPLSHDEVVHGKSPMMYKMPGDDWQKLANLRLMYSYMFTHP
GTKLLFMGDEFGQTTEWNYKSELDWHLLEHLSHQGLQRYVKALNHLYTSEPALYIKQFEY
YGFEWVNVSDYDNSILAYLRKSYKPEEDMLIVLNMTPAAHELYQLGIDGGGTWQEILNSD
HAEFFGSGVVNAGILEAQALPLNGKTHSLQLRIPPLGASIFKRAIK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaataaaaagtcgaagttacagccggtagtacccttttccctgctttccgcc
agggatgtagaactgtttcaggaaggaactcacgcgcacctgtatgagaaattcggggcg
catacattggaatatgaaggcgtaaaaggaacttatttcgctgtctgggcgcctaatgct
gcatatgtatccgttatcggagatttcaacgaatgggatcattatagtcacactttgtac
ccgagatgggacaagtccggcatatgggaaggcttcatcccacaggtaaaaaaaggcgcg
ctctataaatattttatccgatccaattccggggaagaactgcgaaaaggagatccttac
gctaactattgggaacagcgtccgttgacggcttctgtaacctggcagctggattataaa
tggaaagacaagcgctggatggaacagcgtcataaacataatagcctggaaagtcctttc
agtgtatatgaagtacacctgggctcctggcgccggcctgataaatctaatcacgaatta
ttctatacatacgcggaaatagccgccatgctggtaccttacgtaaaggatatgggtttc
acccatgtggaactgatgccggtcatggagcatccttttgatggttcctggggataccag
ggtaccggttattatgcacctacttcaagatacggttctccgcaggatttcatggctttt
gtcgacgcatttcatcatgcaggtataggtgtcatcctggactgggtgccttctcatttc
ccttatgacgcccatggattgtacagattcgatggcgcgcatacttacgagtatgccgac
atgcgtaagggctatcatcctgactggaacagctatattttcaactatgcccgtagcgag
gtacgttcattcctgctcagtaatgccgtattctggctggagaaataccatatagacggg
ctgcgggtggatgccgtcgcctccatgattcacctgaattactcccgtgaggcaggggca
tgggagcccaatgaactgggaggagaggagaacctggaagcagtgtcgttcctgaaacat
atgaatgagacgatctacaaattgtttccggatgtgcagacgatcgcagaggaatctacc
aacttctatggcgtatcccgacctgtttatatgggtggacttggatttggtatgaaatgg
atgatgggctggatgaatgataccctggcttattttaagcgcgatccttatcaccgtaaa
tggcaccaggatcagctgaccttcagtattgcctatgcatttacggagaatttcatgctg
ccgctcagccatgatgaagtggtacacggtaaatcgcctatgatgtataaaatgccgggc
gatgactggcagaagctggccaacttacgcctgatgtacagttatatgtttacccatcct
ggtactaaactgctgttcatgggcgatgaattcggacagacaaccgagtggaattataaa
tcagaactggactggcatctgctggaacacctctctcaccagggcttacagcggtacgtt
aaagcgctgaatcacctgtatacctccgaacccgcattatatatcaaacaattcgagtac
tatggcttcgaatgggtgaatgtatcggattatgataatagtatactggcctatctccgt
aagagctacaaaccggaagaagatatgctgatcgtgctcaatatgaccccggcagcccat
gagctgtatcagttaggtatagacggcggcggcacatggcaggagattcttaatagcgat
cacgccgagttttttggtagtggagtagtgaatgcaggcatattggaggcacaggcgctt
cccctgaacggaaaaacccattctttacaactccgcatccccccgctgggcgcgagtatt
ttcaaaagagcaataaaataa

DBGET integrated database retrieval system