KEGG   Chitinophaga pinensis: Cpin_3403Help
Entry
Cpin_3403         CDS       T00959                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cpi  Chitinophaga pinensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cpi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4196538..4198412
Genome map
AA seq 624 aa AA seqDB search
MCGITGILDFGKRKRVEREEVKKMADAIQHRGPDDFAYLIEDNIGLGFRRLSIIDLAHGQ
QPFYSEDGSVVLICNGEIYNYKELRQELIAKGYRFKTECDVEVIVHLYVAYGIDFINRLN
GQFAFCIYDKKQDTMYLARDQFGICPLFYKVVDQMLIFGSEIKALLRNRHVRKEVNPTAL
DQLFSFPGIVSPVTFFKDINSLKAGHYLKVKGTDIQVKEYWDLDYPLESIHQEEKDEDYY
VDRLEELLLKSVKYRLNADVPVGFYLSGGLDSSLIASMMKRLNPDASYKSFSIGYPRAED
SEHDERIYQRLVANKVNSIHKEIEFDWSQVAAKLKDAVYFSEGALKESYNTCSLALSENV
RNSDIKVVLSGEGSDELFGGYVGYRFDVQRRGFERPAGLEEMLEAQLREKLWGDPDFFYE
TNHYDFRNTTKAVYSNKINDNFDTIDCLETLPINKSRLEGRHPFHKRSYLDLKLRLSDHL
ISDHADRVNYANSVEGRYPFLDIELVDFIKTIPPAVKLKHMTEKYILKQVARRYLPESIS
TRQKFSWVAPGSSQLLQNNVEWINDMLSYSQIKRQGYFNPDTIERIKRIYSAPDFRLNLP
YDTDLLIIVLTFNTFLEVFDMPSL
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaataacaggaattttagatttcggaaaacgtaagagagttgaaagagaagag
gtaaagaaaatggcagatgcgatccagcaccgtggtccggacgattttgcttatttgatt
gaagataatatcggtctgggcttcagacgcctgagcatcattgacctcgcgcatggacaa
cagcctttctacagcgaagacggcagcgtagtgctgatctgtaacggagaaatttataac
tacaaggaactgcgtcaggaactgatcgcaaaaggatatcgcttcaaaacagaatgtgat
gtcgaagtgatcgtacacctctacgtagcctatggtattgatttcatcaacagattgaac
ggacagttcgccttctgtatctatgacaaaaaacaggataccatgtacctggccagagac
cagtttggtatttgtccgctgttctacaaggttgtagatcagatgctgatattcggttct
gagatcaaggccctgctgagaaacaggcacgtaagaaaagaagtaaatccgacggcactc
gaccagctgttttctttccctggtatagtaagtccggttacgttctttaaagacattaac
agcctgaaagcaggacactatctcaaggtaaaaggcacagatatacaggtaaaagaatac
tgggacctggattatccccttgagtcgatccatcaggaagaaaaagatgaagactattac
gtagaccgtctggaagagttgctcctgaaatcagtgaaatatcgcctgaatgcggatgtg
ccggtgggtttctatcttagcggcggactggattccagtctgatcgcttctatgatgaag
cgcctgaatccggatgcatcttacaaatccttttcaattggttatccccgtgcagaagat
agcgagcacgatgaaagaatataccagcgcttagtagcaaataaagtaaattctattcac
aaagagatagaatttgactggtcacaggtggctgcaaaactgaaagacgctgtttacttt
tcagaaggtgccttaaaagaatcttacaacacctgctcccttgctttgtctgaaaacgta
cgtaatagcgatatcaaagtagtgctctccggcgaaggttctgatgaattgttcggtgga
tatgttggttaccgttttgatgtacagcgcagaggttttgaaaggccggcaggactggaa
gaaatgttggaagcccaattaagagagaagctctggggagatcctgatttcttctatgaa
acaaatcactacgatttcaggaatacgaccaaagcagtatattccaataagatcaatgac
aacttcgatacgatcgactgtctggaaacattacctattaacaagagcagactggaaggt
cgtcatccgttccataaacgttcttacctggatctgaaattacgcttgtcagatcacctg
atctccgatcatgccgacagagtgaattatgccaattctgtagagggtcgttatcctttc
ctggacatcgaattggtagattttatcaagacgatcccgcctgcggtgaagctgaagcac
atgacggagaaatacatcctgaaacaggtggcgagacgttatctgccggaaagtatcagc
actcgtcagaaatttagctgggtagcaccgggcagttcacagctgctgcagaataacgtg
gaatggattaatgatatgttgtcttacagccagatcaaacgtcagggttatttcaacccg
gacacaatagaaaggatcaaacgtatttattcagcacctgatttcagactgaatctgcca
tacgataccgatctgctgatcattgtactcacattcaacaccttcctcgaagtattcgat
atgccctccctctag

DBGET integrated database retrieval system